KEGG   Pyrobaculum aerophilum: PAE2819Help
Entry
PAE2819           CDS       T00073                                 

Definition
(GenBank) stress induced protein, conjectural
  KO
K06215  pyridoxal 5'-phosphate synthase pdxS subunit [EC:4.3.3.6]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00750  Vitamin B6 metabolism
Brite
KEGG Orthology (KO) [BR:pai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PAE2819
Enzymes [BR:pai01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.6  pyridoxal 5'-phosphate synthase (glutamine hydrolysing)
     PAE2819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SOR_SNZ ThiG Dus His_biosynth NMO IGPS NanE TetR_C_27 OMPdecase Glu_synthase PA
Motif
Other DBs
NCBI-ProteinID: AAL64457
UniProt: Q8ZUF0
Position
1666365..1667375
Genome map
AA seq 336 aa AA seqDB search
MSVVGSFEQLERLRDLFYKLLDLRDTLRERGVAWPKPLSEEAALGTVRVKVGFPAMLKRG
VIMDVTNVEQAQIAEDAGAVGVMVLDKLPYDVRRAGGVARMADLKVIEEVMAHVTIPVSA
KVRIGHYYEAFLLEQVGVDLIDESEVLTPVDEQHHINKWMFTVPFVNGARELCEALRRIS
EGASMIRSKGEAGTGNVAEAVKHFKSIYGAIKSLAAGDEERVRDFARQCQVPFELVALTA
KLQRLPVITFAAGGIATPADAALMMWLGADGVFVGSGIFKSQDPRERAEAIVLATAHWDD
PETVVEAQKMVSERGAMMGIDIRTLKPEELLQTRGV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggtggggagttttgaacagctggagaggttgagggatttgttttacaaactc
ctcgacttaagggacacactgcgtgagaggggggtggcgtggcctaagcctctttctgag
gaggcggccctcggcactgtgagggttaaggtggggttccccgcgatgttgaagaggggg
gtgattatggacgtgacaaacgtggagcaagcccaaatcgctgaggacgccggggcggtg
ggagtaatggtgttggacaaactgccttatgacgtgaggagggcgggcggcgtggccaga
atggcggatttaaaggttattgaggaggtcatggcccacgtgactatcccagtgtccgcc
aaagtgagaattggccactactacgaggcttttctgttagagcaagtcggcgttgactta
atagacgagtctgaggtattgactccagtggatgagcaacaccatataaataagtggatg
ttcacagtgccctttgtaaacggggctagggagctctgtgaggcgttgcggaggatttca
gagggggcctccatgattagatctaagggagaggcggggactggcaacgtggccgaggcc
gtcaagcacttcaagtctatatacggagctataaaatcgctggcagctggcgacgaggag
agagtcagggatttcgccaggcagtgccaagtgccctttgagctcgtggccctcaccgct
aaattacaaaggctgcccgtcattacattcgccgcggggggcatagccactcccgccgac
gccgcccttatgatgtggctcggagctgacggcgtgttcgtgggctctgggattttcaaa
tcgcaagaccccagggagagggctgaggccattgtcttggccactgcccactgggacgac
ccggagactgtagtagaggcgcagaaaatggtcagcgagagaggcgccatgatgggaata
gatataaggactttgaagcctgaggagcttttacagactagaggcgtatga

DBGET integrated database retrieval system