KEGG   Pyrobaculum aerophilum: PAE3276Help
Entry
PAE3276           CDS       T00073                                 

Definition
(GenBank) 2-ketoacid ferredoxin oxidoreductase delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00010  Glycolysis / Gluconeogenesis
pai00020  Citrate cycle (TCA cycle)
pai00620  Pyruvate metabolism
pai00633  Nitrotoluene degradation
pai00640  Propanoate metabolism
pai00650  Butanoate metabolism
pai00680  Methane metabolism
pai00720  Carbon fixation pathways in prokaryotes
pai01100  Metabolic pathways
pai01120  Microbial metabolism in diverse environments
pai01130  Biosynthesis of antibiotics
pai01200  Carbon metabolism
Module
pai_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAE3276
   00020 Citrate cycle (TCA cycle)
    PAE3276
   00620 Pyruvate metabolism
    PAE3276
   00640 Propanoate metabolism
    PAE3276
   00650 Butanoate metabolism
    PAE3276
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PAE3276
   00680 Methane metabolism
    PAE3276
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PAE3276
Enzymes [BR:pai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PAE3276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_21 Fer4_6 Fer4_2 Fer4_16 Fer4_9 Fer4_10 Fer4_17 Fer4_13 Fer4_4 Fer4_8 Fer4_15 Fer4_22 Fer4_18 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AAL64806
UniProt: Q8ZTF5
Position
complement(1966829..1967080)
Genome map
AA seq 83 aa AA seqDB search
MLPLSKPAPASAGITGTWRTYKPVVNLSKCIDCGLCWLYCPESVIDWEKGTKVRIDYDFC
KGCGICADVCPVKAIDMVPEAGV
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcccctctcaaaacccgccccggcctctgccggcattacgggcacgtggcgcact
tacaaaccagtagtcaatctcagtaaatgtattgattgcggcttatgttggctctactgc
ccggagtcggtaatagactgggaaaaagggacaaaggtgagaatagactatgacttttgt
aaagggtgtggcatatgcgcagatgtgtgcccagtaaaggcaattgacatggtgccggag
gcgggggtatga

DBGET integrated database retrieval system