KEGG   Paenibacillus sp. IHB B 3084: ASL14_00655Help
Entry
ASL14_00655       CDS       T05348                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
paih  Paenibacillus sp. IHB B 3084
Pathway
paih00471  D-Glutamine and D-glutamate metabolism
paih01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paih00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ASL14_00655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paih01011]
    ASL14_00655
Enzymes [BR:paih01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     ASL14_00655
Peptidoglycan biosynthesis and degradation proteins [BR:paih01011]
 Precursor biosynthesis
  Racemase
   ASL14_00655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race ANF_receptor
Motif
Other DBs
NCBI-ProteinID: ALP34902
UniProt: A0A0S2RZP3
Position
complement(149048..149851)
Genome map
AA seq 267 aa AA seqDB search
MKIGFFDSGLGGITVLSEALRRLPNENFVYLADTLHVPYGTKTPQEVCGYVKASVQTILK
EDVKALVIACNTATSIAVAELRNEYQIPIIGMEPAVKPAVEMNRANGKRVLVLATPLTLK
QSGYAALVSRVDDHGSVDSLPLPELVHYCEQLNFDRTEMAEYFNCKLAAFDLDLYGTVVL
GCTHYPFYKEILKGLLPSHIQLIDGSQGTVRRLKQVLSDRNLLASPAKAGQSQEGHITFL
CTSQDADYVHKMERALEIYAEHEKISF
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttgaagattggtttttttgattcaggattgggtggaattacggtattatctgaggcctta
cgacggctgccaaacgaaaattttgtatacttggcggatacgcttcatgttccttacggg
acgaaaacaccgcaagaggtatgcggatacgtcaaggcttcggtacaaactattttaaaa
gaggacgttaaagcgctggtcattgcctgcaatacagccacgagtatcgcggttgcggag
ctgagaaacgaataccagattccgatcattggcatggagccggccgtgaagcctgcggta
gagatgaatcgagcgaatggtaaaagagtgctagtgttagccacgccgttgacgttaaag
caatccggttatgcagcactggtgtccagagttgatgatcatggaagtgtggattcgttg
cctttgcctgagctggtgcattattgtgagcagttaaattttgaccggacagaaatggcc
gaatattttaactgtaagctggctgcgttcgatctggacttatacggtacggtcgttttg
ggatgtacccactatcctttttataaagagatcttgaaggggctgcttccttcccatatt
cagctaatcgacggaagtcagggaacagtcagacggttaaaacaggtgttgtctgatcgc
aatttgctggcatctccggcaaaagcaggtcaatcgcaggagggacacattacgttcctg
tgtactagtcaggatgcggactatgtccataaaatggagcgtgcgcttgaaatttatgcg
gagcatgagaagatttctttttaa

DBGET integrated database retrieval system