KEGG   Paenibacillus sp. IHB B 3084: ASL14_12350Help
Entry
ASL14_12350       CDS       T05348                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
paih  Paenibacillus sp. IHB B 3084
Pathway
paih00020  Citrate cycle (TCA cycle)
paih00620  Pyruvate metabolism
paih01100  Metabolic pathways
paih01110  Biosynthesis of secondary metabolites
paih01120  Microbial metabolism in diverse environments
paih01130  Biosynthesis of antibiotics
paih01200  Carbon metabolism
Module
paih_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paih_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ASL14_12350
   00620 Pyruvate metabolism
    ASL14_12350
Enzymes [BR:paih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     ASL14_12350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO HI0933_like TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: ALP36834
UniProt: A0A0S2S5H1
Position
2694000..2695499
Genome map
AA seq 499 aa AA seqDB search
MSNIQKKTDVILIGAGVMSATLGSLLKELAPEWEITVFEKLASAGEESSNEWNNAGTGHA
ALCELNYTSEKADGSIDISKAVNINEQFQLSRQFWSFLVNSDLIRNPQDFIKPIPHMSLV
SGEKNVSFLKKRFKALSNVSLFQGMEFSNDPEKLKEWIPLIMEGRTSNEPIAATKIDSGT
DVNFGALTRLLFDHLKSKNVEIKYKHSIKDIKRTRDGSWEVKVHNLDNGKIEYHTAKFIF
IGGGGGSLPLLQKTGIPESKYIGGFPVSGLFMVCNNPKVVAQHHAKVYGKAKVGAPPMSV
PHLDTRYIGDKKALLFGPFAGFSPKFLKAGSNLDLICSIKPNNLFTMLAAGVKEMALTKY
LIQQMMLSNEKRLEELREFIPNANIEDWEIVVAGQRVQVIKDTEVGKGTLQFGTEVVSAA
DGSIAALLGASPGASTAVNVMLEVLERCFPQHMKEWEPKIKEMIPSHGVSLAENPELFQE
IHAFTTQALGLGEKEPLHR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatacagaaaaaaacagacgttatcttaattggtgccggagtcatgagcgcg
actctgggatcattgctgaaagagttagcaccggaatgggaaatcacagtgtttgagaaa
cttgcaagcgcaggagaagaaagctctaacgaatggaataatgccggtacgggccatgct
gcactgtgcgagctgaactatacatccgagaaagctgacggatctatagatattagtaaa
gctgtaaacattaatgagcagtttcagctctcaagacagttttggtcttttcttgtaaac
agcgatttgattcgtaatccgcaggactttatcaagccaatacctcatatgagtttggta
agcggagaaaaaaatgtatcttttttaaaaaagcgatttaaagcgctatcaaacgtttct
ctgtttcaaggaatggaattttccaatgaccctgaaaagctgaaagaatggattccgctg
atcatggaaggccgcacatcgaatgaaccgatcgcggcaaccaaaatcgactccggaaca
gatgtcaactttggtgctttaacacgtttgttgtttgaccatttaaaaagtaaaaacgtc
gagatcaaatacaagcatagtattaaggatattaaacgcacgagggatggctcgtgggaa
gtcaaagtgcataatcttgataacggtaaaatcgaataccatactgcgaaattcatcttt
atcggcggtgggggcggaagtctgcctttactacaaaaaaccggtattcctgagtccaaa
tatattggaggattcccggtaagtggactatttatggtatgtaacaatcctaaagttgtc
gcgcagcatcatgcaaaagtatacggtaaagctaaggttggtgctcctcccatgtctgtt
ccgcatctggatacaagatatatcggcgacaaaaaagcactgttgtttgggccgtttgct
ggcttctcaccaaagttcttgaaagcgggttcaaatttggatctgatctgttctataaaa
ccaaataacctcttcacgatgttggcagcaggtgtaaaagagatggcgttgaccaaatac
ctgatccagcaaatgatgttatcgaatgaaaagcgcctggaagaattacgcgagtttatt
ccgaacgccaatatcgaggactgggagatcgtggtagcgggtcaacgtgtgcaggtgatc
aaagatacggaggtcggtaaaggcacccttcaatttggtacggaagtggttagtgccgct
gatggctcgatagctgcattgctcggcgcttctccgggtgcttctactgctgttaacgtt
atgctggaagtattagaaagatgcttcccacaacatatgaaagagtgggaaccgaaaata
aaagaaatgattccttctcatggcgtgtcactggcggaaaacccagagcttttccaagaa
attcatgctttcacaacgcaggcgctgggtttgggcgaaaaagaaccgcttcatcgttaa

DBGET integrated database retrieval system