KEGG   Paenibacillus sp. IHB B 3084: ASL14_21425Help
Entry
ASL14_21425       CDS       T05348                                 

Definition
(GenBank) glycine--tRNA ligase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
paih  Paenibacillus sp. IHB B 3084
Pathway
paih00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:paih00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ASL14_21425
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paih01007]
    ASL14_21425
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:paih03016]
    ASL14_21425
Enzymes [BR:paih01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     ASL14_21425
Amino acid related enzymes [BR:paih01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   ASL14_21425
Transfer RNA biogenesis [BR:paih03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    ASL14_21425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: ALP38357
UniProt: A0A0S2S9H0
Position
4680844..4682919
Genome map
AA seq 691 aa AA seqDB search
MSKDLLFEIGLEEVPARFIPAAIQQLKERMTAWLDSSRIAHGDVEAYATPRRLAVLVKEV
AEKQEDINEEVKGPSRKIALDEAGNWSKAALGFARSQGVDPEQFTFKELGGVEYIYATKS
SIGVPTAEVLSEGLLHILHAMTFPKFMRWASYDFKFVRPIRWLIALFGNDIVNLEIAGVQ
SGNVTRGHRFLGQDTVVESPADYVELLRKQHVIVDIAERQSIIVKQIEALAAEKDWTIAV
KDDLLEEVLYLVETPTVLFGGFDPSFLNIPKDVLITSMREHQRYFPVLDREGELLPYFVT
VRNGGSQSLDVIAKGNEKVLRARLSDAKFFYEEDQRLEIKDALSKLESIVFHEELGTVGD
KVRRIRRIADALAEKLRVSPDTQESVSRAADICKFDLVTQMVYEFPELQGVMGEDYARKA
GEKEEVARAVFEHYQPRFAGETVPSTNAGAIVSIADKIDTITGCFSIGIIPTGSQDPYAL
RRQAAGIVQILLDRNLSATLSDVFNIALDVHDNLGNMKRSADEIRKELHEFFGLRVKKLL
SETLRYDVVDAVLTAGFDDVASVVNRGAALMNGVQTGDAFKATVESFNRVGNLAAKAVHA
SVNTDEFTEQGEKALYEAWYGVYESYLTALQEGDATRALELASSITPAITAFFDSVMVMA
ENDAIRNNRLALLAAIDTELKRFADFSKLVG
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaggatttgctgtttgaaatcggtttggaagaagtgcccgcccgttttattcct
gctgcgattcagcagttaaaggagcgtatgacggcatggttggacagctcacgtattgct
catggtgatgtagaagcttatgctactcctcgtcgtctggcagtgctggttaaggaagta
gccgaaaagcaggaagatattaacgaagaagtcaaaggtccttcccgcaaaatcgcactt
gacgaagccggtaattggagcaaggctgctctcggctttgcccgtagccaaggtgttgat
cctgaacagtttacgttcaaggagcttggaggcgtggagtatatttacgcgaccaagagc
agtataggcgtaccgacagcggaagtgctgtccgaaggcctgttgcatattttacatgct
atgacctttcctaaattcatgcgttgggccagctatgactttaagtttgttcgtccaatc
cgctggttgatcgccttgtttggcaacgatattgttaacctggaaattgccggggttcaa
tctggaaatgtcacaagaggacatcgttttctcggacaggatactgttgtagaaagcccg
gctgactatgttgagttacttcgcaaacagcatgttatcgtagatattgcggaacgtcag
tccattattgtgaagcagattgaagcgttggctgccgaaaaagactggacgatcgcggtt
aaggatgatctgctggaggaagtgctgtatctggttgaaacgccgacggtgctgttcgga
ggctttgatccttcgttcctcaacattcccaaggatgtgctgattacttctatgcgtgag
catcaacgctatttcccggttctggatcgtgagggagagctgttgccatactttgttacg
gtacgtaacggaggaagtcaatcactggatgtgatcgccaaagggaacgaaaaagtattg
cgagcacggctatctgatgccaaattcttttatgaggaagatcagagactggaaatcaag
gatgcgctctccaagctggaaagtatcgttttccacgaggaattgggtacggttggagac
aaggtacggcggattcgccgcattgccgatgctttagctgagaagctgcgggtttccccc
gatacacaggagtcggttagccgggcagcagatatttgtaagtttgatctggtaacgcaa
atggtatatgagtttccggaactgcaaggggttatgggtgaggactatgcccgtaaggct
ggagagaaggaagaagtggcgagagcggtgtttgaacattatcaaccgcgttttgccgga
gaaacggttccttccacgaacgcaggggctattgtcagcatcgctgataaaattgatacg
attaccggctgcttctccatcggtattattccgacaggctcacaggacccttatgcgctt
cgtcgccaggccgcaggtattgtgcagattttgctggatcgtaatctttcagcaactttg
tctgatgtgttcaatattgcgcttgacgtacacgacaaccttggaaatatgaaacgttct
gccgatgaaattcgtaaagagttacatgaattcttcggtttgcgggtgaaaaagctgttg
tccgagacacttcgttatgacgtcgtagacgctgtgcttaccgccggatttgatgatgtt
gcttctgtcgttaatcgcggagctgctctgatgaatggggtacaaacgggagatgccttt
aaagcaacggtagagtcgtttaaccgcgtaggcaatttagctgcaaaagctgttcatgca
tcagttaatacggatgaatttacggaacagggtgaaaaagcgctatatgaagcatggtac
ggcgtttatgaatcttatcttacagcattgcaggaaggcgatgccacgcgagctttagaa
cttgcctcgtccattactcctgcgatcacagcgttctttgattccgtaatggttatggct
gagaatgatgcgattcgtaataatcgtctggcattgctggccgccattgatacagagctg
aagcgttttgctgatttttccaaactggtgggctaa

DBGET integrated database retrieval system