KEGG   Paenibacillus sp. IHB B 3084: ASL14_22685Help
Entry
ASL14_22685       CDS       T05348                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
paih  Paenibacillus sp. IHB B 3084
Pathway
paih00010  Glycolysis / Gluconeogenesis
paih00071  Fatty acid degradation
paih00350  Tyrosine metabolism
paih00620  Pyruvate metabolism
paih00625  Chloroalkane and chloroalkene degradation
paih00626  Naphthalene degradation
paih00650  Butanoate metabolism
paih01100  Metabolic pathways
paih01110  Biosynthesis of secondary metabolites
paih01120  Microbial metabolism in diverse environments
paih01130  Biosynthesis of antibiotics
paih01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:paih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASL14_22685
   00620 Pyruvate metabolism
    ASL14_22685
   00650 Butanoate metabolism
    ASL14_22685
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ASL14_22685
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ASL14_22685
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ASL14_22685
   00626 Naphthalene degradation
    ASL14_22685
Enzymes [BR:paih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ASL14_22685
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ASL14_22685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ALP38569
UniProt: A0A0S2SA18
Position
4961105..4963717
Genome map
AA seq 870 aa AA seqDB search
MAVKNEVIQKEQSAEQYIQTLIDRGNRAQQAFMSMNQEQIDEIVQAMAIAGMDKHMHLAK
LAVEETGRGVYEDKIIKNMFATEYVYHSIKNEKTVGVIEDNDFDSFQKIAEPVGIIMGIT
PVTNPTSTTMFKALIAIKTRNPIIFGFHPSAQSCSAEAARVLLEAAVKHGAPADCIQWIE
APSMDKTNSLMNHPDVALILATGGSGMVKAAYSCGKPALGVGPGNVPCFIEKTADIKQAV
NDLILSKSFDNGMICASEQAVIIEEPIFEQVKKLMIANGCYFVNKEEAAKLTQGAMNVEK
CAVNPAIVGQSAVKIAEMSGITVPAGTKILVAEIEGVGTKFPLSAEKLSPVLACYKVKNA
EQGIQRAAEVVEFGGMGHSSAIHSNDEDVIARFANRLQTGRIIVNSPSTHGAIGDLYNTN
LPSLTLGCGSYGRNSTSSNVSAVNLINVKRVAKRTVNMQWFKVPSKIYFEKNSTQYLAKM
PDITRVAIITDPMMVKLGYVDRVIHYLHQRQTPVAIEVFSEVEPDPSTVTVERGTEMMRR
FQPDCIIALGGGSPMDAAKGMWMFYEYPDTDFNNLKQKFMDIRKRIYKYPRLGQKAQFVA
IPTTSGTGSEVTSFAVITDKNQGNTKYPLADYELTPDVAIIDPEFVYSLPKTAVADTGMD
VLTHAIEAYVSVMASDYTDGLAIKAIQLVFQYLEQSALSGDKLAREKMHNASTLAGMAFA
NAFLGINHSLAHKWGGQYHTAHGRTNAILLPHVIRYNAKKPTKFASFPKYSHFVADERYA
EIARILGLPARTTEEGVNSLIEAIRKLNKTLGIEESFQQIGFDAKDFESRVDYLADRAFE
DQCTTANPKLPLVTELADVYRNAFYGRFDQ
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggctgttaaaaacgaggttatccaaaaagagcaaagcgctgagcagtatattcaaaca
ctgattgaccgggggaaccgggcacagcaggctttcatgagtatgaatcaggagcagatt
gacgaaatcgtacaagctatggcaattgcagggatggataagcacatgcatctggcgaag
ctggctgttgaagaaacaggacgcggtgtgtatgaggacaaaatcattaaaaacatgttt
gcaacagaatatgtctatcatagtatcaaaaatgaaaaaaccgttggtgtcattgaagat
aatgactttgacagttttcaaaaaatagcagagcccgtcggcatcattatggggatcact
ccagtgactaatccgacttcaactacaatgttcaaagcgttgattgctattaaaacacgt
aacccgatcatctttggtttccatccatccgctcaatcgtgtagtgcggaagcagctcgc
gtcttgcttgaagcagccgtcaaacatggtgctccggccgattgtattcaatggattgaa
gctccatcgatggataagacaaattcactcatgaatcacccggatgtggcgctgattctg
gcaactggtggatcaggcatggttaaggcggcatatagctgcggtaaacctgctctgggt
gtaggcccaggtaacgtgccttgctttattgaaaaaacagcagacatcaagcaggccgtg
aacgatctcatcctctccaaatcttttgacaacggtatgatttgtgcttccgagcaagcg
gttattatcgaagagccaatcttcgaacaagtgaaaaaattgatgatcgctaacggttgc
tattttgtaaataaagaagaagcagctaagctcactcaaggagctatgaatgtcgagaaa
tgtgcagtgaacccggccatcgtcggacagtctgctgtgaaaattgctgaaatgagtggt
atcacagtaccagcaggaactaaaattttggtcgctgagattgaaggggtaggaacaaaa
ttcccattgtctgcggaaaaattgagtcctgtattggcttgctataaagtaaaaaatgcg
gaacaaggtattcaacgcgctgctgaagtcgtggaattcgggggcatgggccactcgtcc
gctattcattcgaacgatgaggacgttatcgctcggttcgcaaaccgtttgcaaacaggc
cgtatcattgtaaattcgccttccacacatggtgcgatcggtgacctctacaacaccaac
cttccatcgctgacactcggttgtggttcgtacggacgtaactcgacttcgtcgaacgta
tcggcagtcaacttgattaatgtgaaaagggtggcgaaacgtacggtgaatatgcaatgg
ttcaaagtaccttccaaaatttattttgaaaaaaattcgactcagtatcttgctaaaatg
cctgatatcacacgtgttgccattatcacagaccctatgatggtgaaactcggatatgtg
gatcgtgtcatccattatttacaccagcgccaaacaccagtagctatcgaagtgttctcg
gaagtagagccagatccatcgacagttacggtagaacgtggtactgaaatgatgagacgt
ttccaaccggattgcattattgcattgggcggcggttcgccgatggatgcggctaaaggc
atgtggatgttctatgaatacccagatactgatttcaacaacttaaaacaaaaattcatg
gatatccgcaaacggatctacaagtacccgcgtcttggtcagaaagcacaatttgtagcc
attcctacaacctcgggtacaggttcggaagttacgtcgttcgcggttattacagacaaa
aatcagggcaacacgaagtatccgctggctgactatgagctgactcctgatgtggcaatt
attgaccctgagtttgtatactcgctgcctaaaacagctgtagcagatacaggtatggac
gtactgacacatgccatcgaggcctacgtgtctgtaatggctagtgactacacagacggt
ctggcaattaaagccattcaactggtattccaatacctggagcaatcggctctgagtggc
gacaaactggctcgtgaaaaaatgcataatgcttccacactggcagggatggcgtttgcc
aatgcattcctgggtattaaccacagtcttgcgcacaaatggggcggacaataccataca
gcgcacggtcgcacgaatgccattttgttaccacacgtcattcgttataatgcgaaaaaa
ccgacgaagtttgcttcgttccctaaatattcgcactttgttgcggatgagcgttatgca
gaaattgcacgcatactgggactgcctgcccgtacaacggaagaaggggttaacagtctg
atcgaagcgatccgcaagttgaacaaaacactcggtatcgaggaatcgttccagcaaatc
ggcttcgatgcgaaggattttgaatcgcgtgtagattatctggctgaccgcgcttttgag
gatcaatgtacaactgcgaatccgaagctgccgctggttaccgaattggctgatgtatac
cgcaatgccttctacggacgttttgaccaataa

DBGET integrated database retrieval system