KEGG   Pantoea ananatis AJ13355: PAJ_0397
Entry
PAJ_0397          CDS       T01969                                 

Gene name
rhsD
Definition
(GenBank) protein rhsD precursor RhsD
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: RHS_repeat PAAR_motif RHS DUF4595
Other DBs
NCBI-ProteinID: BAK10477
UniProt: A0A0H3KSV3
Position
complement(488026..492213)
AA seq 1395 aa
MFEAARLGDDIGHSHALAGMIAGTIVGGLIAAAGGIAAGALMIAGIGASCLGVGVLLVGL
SIGVGYLTGELATAARDGIADAGAASMTPKGKITTGSPNVFINSKPAAMATNSIVACKDD
GPQQMAEGSSRVYINGLPASRIDDRTTCDAKVMTGSDNVYIGGEPEQTLPIQPEVPEWVY
KASDLTLLFAGLAGGVGGAAGKVGALGKLLSKIPGINKIARVACRAGALMTGVAAAGILA
RPVDIVSGQKFLSGDDELDFVLPSRLPLRWQRYWRSGNPGDSVLGRGWNLFWETRLERYQ
DGLVWRASSGDYVSFPLVPKGQRTYCEAEKRWLEHHRDDSWSLYDISGERWHFMPLRDDA
PSLPLCLTEPCGNEIQFDWNPDHTLAALTDSAGQRVTCRYANNRLAGAWLDDDICLVSYA
YDDIGQLVTVTGRGGSVRRRFQWCDGLMVAHEDMNGLLSEYRWQEIDGLPRVVAFRHSGG
EQLDFEYDFDNGIRRARRDDGVEAHWLIDDDDHVARFTDFDGRQTMLVYRAGELCDVIMP
GGAMRCSNWDRYGRMTQEIDPVGRRTTYHWFRMTDRVIRTDYPDLSATQAAYDLNVRLLT
ETDALNNVTTYHYPDDTELLPDSITDATGGVVKLEWNRQGLLTQRTDCSGSVTTFSYDRF
GQLVRSVDAEGHVTQREWNDKGQLCAIIHPDGSRETLHWNTQGQLSAWRDPLETEVRWTY
NALGLPVSLTDRIGRTRRWHYDARGNLLRLENGNGGDYRFTCDPLGRPLSEIRPDKTSRN
MEWNARGFLIGLQENGQPANDGGIARRWQRFSYDDSGLITQRTTQHAEYHYRRHRSGQLA
SLVRTPTSDGMALGIEDDEIAFTYDVAGQLLTEAGINGKLDYEWDALGNLTHLTLPGEQQ
LAWLHYGSGHVSAIRFNQQLVSEFTRDRLHREIRRSQGAREQARQYDSLGRRTMQRSELH
SEVVLPEKAILERAFRYSARSELESVSDTLRGDIIYGYDDEGRLLKHYEARQGHSTSHFA
YDNADNLAANDDALHALPVTDNRLHHWQNLFMKYDDWGNLVSRRSGLHEQHFTYDAENRL
ISAKGNGPDGGFTAHYHYDALGRRTRKVVSTQHDRKEVRFLWQGYRLLQEQHENGQCQTY
VYDPNEAWSPLARIDHMAAGERGDVLWFNTDLNGAPLEVTDERGDIRWSGQYGSFGEVRR
QTEGFTRLAKQSALPHQPLRYAGQYADSETGLHYNLFRYYDPQVGRFTVQDPIGLEGGWN
LYQYAPNPLSWIDPLGLNKCGSFTKNPDDIHFMQSSIKNQTGEHTVLNNAAALKNGTLKP
TDLPAIKIWQDSSGKLWTLDHRRLAAFKLSGLKEIPVQWATEKEIAGQMWKMTTKTDGKS
IILKMGDGIKRVIGG
NT seq 4188 nt   +upstreamnt  +downstreamnt
atgtttgaagctgcacgcctcggcgatgatatcggtcactctcatgccctggcgggcatg
attgcaggcactatcgtcggtggactgatcgctgcggcgggcggtattgctgcgggtgca
ttgatgattgccgggataggcgcctcctgccttggcgtgggcgtattgctggttggactc
agtatcggcgtgggttaccttactggcgaactggccacagccgcgcgagacggaatagcg
gatgctggggcggccagcatgaccccaaagggcaagattaccaccggttcgcccaacgtc
tttattaacagtaaacccgccgccatggccaccaacagcatagtggcctgcaaggacgat
ggtccgcagcagatggcggaaggctcctcccgggtgtatatcaacggcctgcctgcatca
cgcatcgacgatcgcaccacctgcgatgccaaagtgatgacgggctctgacaacgtctat
atcggcggcgagcctgaacaaacgctgcctatccaacctgaagtgcccgaatgggtttat
aaagcctccgatcttaccctgctgtttgccgggctggccggtggcgtgggcggtgcggct
ggcaaggtcggcgcgctgggtaaattactgagcaagattcccggtatcaataaaatcgcc
cgggtggcctgccgtgctggtgccttgatgaccggtgtggcggccgcaggtattcttgcc
cgtcccgttgatatcgtaagcggccagaagtttcttagcggcgatgatgaactggatttt
gtgctgccctcccggctgccgctacgctggcagcgctactggcgcagcggtaatcccggc
gacagcgtattaggccgtggctggaacctgttctgggaaacacggctggaacgttaccag
gatgggctggtctggcgtgcgtcctccggcgattacgtctcttttcctctggtgccaaaa
ggccagcgtacctactgcgaagcggagaaacgctggctggaacatcatcgggacgacagt
tggtcattgtatgacatcagcggtgagcgctggcattttatgcccctgcgcgatgatgcc
ccttctcttcccctctgcctgaccgagccctgcggcaatgagattcagttcgactggaac
cccgatcacacattggctgcgctgacagacagtgccggtcagcgcgtaacctgccgctat
gcgaataaccggctcgcaggtgcctggctggatgacgatatttgtctggtcagttacgcg
tatgatgatatcggccaactcgttacggtaacgggccggggcggtagcgtgcgccgacgc
ttccagtggtgcgatggcctgatggtcgcccatgaagatatgaatggcctgctaagtgag
tatcgctggcaggagatcgatggcctcccaagagtggtggccttccgtcacagcggcggc
gagcagctggattttgagtacgattttgataatggcatccgacgcgcgcgacgtgatgac
ggcgttgaagctcactggctcattgacgatgacgatcatgtcgcccgctttaccgacttc
gacggccgccagaccatgctggtttaccgcgcaggcgagttgtgcgatgtgattatgccc
ggcggtgccatgcgctgcagcaactgggaccgctatggtcgcatgacgcaggagatcgat
ccggtcggacgtcgaaccacttatcactggttccgcatgactgaccgtgtgatccgtacg
gactatcccgatctgagcgcgactcaggcggcttacgatcttaatgttcgcctgctgact
gaaaccgatgcgctcaataacgtcaccacctatcactaccctgatgacacagaactgctg
ccagacagcatcaccgatgcaacgggcggcgtggtgaagctggaatggaaccgacaaggg
ctgctgacgcagcgcaccgactgctctggcagcgtaacgacgtttagctacgaccgattt
ggccagcttgttcgcagcgtggatgctgaaggtcatgtcacccagcgcgagtggaatgac
aagggacaactctgcgccattatccatccagacggtagccgggaaaccctacactggaac
acccaggggcagctcagtgcgtggcgcgatccgctggaaaccgaagtccgctggacctat
aacgcactcggattaccggtgagcctgacggaccgcattggtcgcacgcgtcgctggcat
tacgatgcccgtggtaatctgctgcggctggaaaacggcaacggcggtgactatcgcttt
acctgcgatccgctcggccgtccattgagtgagatccggcccgataagacctcacgcaat
atggaatggaatgctcgtggctttctcattggtttacaggaaaatggccagcccgctaat
gacggtggcatagctcgacgctggcagcgctttagctacgacgacagcggcttgattacc
cagcgcacaacgcagcatgctgaataccactaccggcgtcatcgtagcggtcaacttgcc
agcctggttcgcacgccgaccagcgacggaatggcgcttggtatcgaagacgatgaaatc
gcctttacctatgacgtcgcaggtcagctcttaacagaagctggtataaacgggaaactg
gattacgaatgggatgcgctgggcaacctcacccatctgaccctgccgggtgaacagcaa
cttgcctggctgcactacggttcgggtcacgtcagcgcgattcgctttaatcagcaactg
gtcagtgaatttacccgcgaccgcctgcaccgggaaattcgccgcagtcagggcgcgcgt
gagcaggcgcgtcagtacgacagccttggcaggcgcacgatgcagcgcagtgaattgcat
agcgaggtggtgctaccggaaaaagccattctggaacgcgctttccgctattcggcgcgc
agtgaactggagtctgtcagtgatacgctgcgcggcgacattatctatggttacgatgat
gaaggccgcctgctgaagcactacgaagccagacagggtcacagcacctcgcattttgct
tacgataacgcggacaacctggcggcaaacgacgatgcactgcacgcgttgccagttacc
gacaaccgtctgcatcactggcagaacctgtttatgaagtacgatgactggggcaacctg
gtcagtcgacgcagcggcctgcatgagcagcattttacctatgacgccgaaaaccggctc
atcagcgccaaaggcaatggcccggacggcgggtttaccgcacactatcattatgatgcg
ctgggcaggcgcacccgcaaagtggtcagcacccagcacgatcgtaaagaagtccgtttt
ctgtggcagggctatcgcctgttacaggagcagcatgaaaacggccagtgccagacctac
gtgtacgatcccaacgaggcctggagcccgctggcgcgcatcgaccatatggcagcaggc
gaacggggcgatgtgttgtggttcaataccgatctcaacggggcaccgctagaggtaacc
gatgaacgcggcgacatccgctggagcggtcagtacggcagctttggtgaagtgcgtcgg
cagacagagggctttacccggctggcaaaacagtctgccctgccccatcagccgctgcgc
tatgcgggccagtatgcggacagcgaaaccggtctgcattacaatctgttccgctattac
gatccgcaggtgggacggttcacggttcaggacccgatagggctggaaggcggctggaac
ctgtatcagtatgcgccgaacccgctgagttggatcgacccgttggggttgaataagtgt
gggagctttacaaagaatcctgacgatatccatttcatgcaaagttcaattaaaaatcaa
acgggcgagcataccgttctcaataacgcagctgctcttaaaaacggtactcttaagccc
actgatttacccgcaattaaaatttggcaagactcaagcggaaaattatggactctggac
cacaggagactggctgcattcaaactgtcagggctgaaagaaataccggtgcagtgggct
acggagaaagaaattgctggccaaatgtggaaaatgactacgaaaacagatggaaaaagt
atcattcttaaaatgggtgatggtattaagagagttataggtggctaa

DBGET integrated database retrieval system