KEGG   Pantoea ananatis AJ13355: PAJ_0492Help
Entry
PAJ_0492          CDS       T01969                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein SdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00020  Citrate cycle (TCA cycle)
paj00190  Oxidative phosphorylation
paj00650  Butanoate metabolism
paj01100  Metabolic pathways
paj01110  Biosynthesis of secondary metabolites
paj01120  Microbial metabolism in diverse environments
paj01130  Biosynthesis of antibiotics
paj01200  Carbon metabolism
Module
paj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
paj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAJ_0492 (sdhD)
   00650 Butanoate metabolism
    PAJ_0492 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PAJ_0492 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: BAK10572
UniProt: A0A0H3L1F8
Position
603027..603374
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIQDWLLLRATAILITLYIIYLLGFVVMTDTLTYDIWRGFFASAFTKVF
TLLTLFSILIHGWIGMWQVLTDYVKPLATRLLLQLVIVVALLSYAIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcatccgcgttgggtcgcaatggcattcaggactggctgctgctgcgc
gcgacggcaatcctcatcacgctttacatcatctatctcctcggtttcgtggtgatgaca
gacacgctgacgtatgacatctggcgtggcttcttcgcttctgcatttacaaaagtgttc
acgctcctgacgctgttttccattctgatccacggctggatcggtatgtggcaggtctta
acggactacgttaaaccgctggcaacgcgtctgctgttgcagttggtcatcgtagtggcg
ctgttgtcatatgcaatttatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system