KEGG   Pantoea ananatis AJ13355: PAJ_0521Help
Entry
PAJ_0521          CDS       T01969                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase GpmA
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00010  Glycolysis / Gluconeogenesis
paj00260  Glycine, serine and threonine metabolism
paj00680  Methane metabolism
paj01100  Metabolic pathways
paj01110  Biosynthesis of secondary metabolites
paj01120  Microbial metabolism in diverse environments
paj01130  Biosynthesis of antibiotics
paj01200  Carbon metabolism
paj01230  Biosynthesis of amino acids
Module
paj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
paj_M00002  Glycolysis, core module involving three-carbon compounds
paj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAJ_0521 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    PAJ_0521 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAJ_0521 (gpmA)
Enzymes [BR:paj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PAJ_0521 (gpmA)
Membrane trafficking [BR:paj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PAJ_0521 (gpmA)
Exosome [BR:paj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PAJ_0521 (gpmA)
  Exosomal proteins of melanoma cells
   PAJ_0521 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAK10601
UniProt: A0A0H3KUA4
Position
complement(635469..636221)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSDKGRTEAKAAGQLLKKEGFVFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWRLNERHYGALQGLDKAETAAKYGDEQVKQWRRGFA
VTPPELDRSDERFPGHDPRYASLKPEQLPTTESLALTIERVIPYWNESILPRIKSGEKVI
VAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPIKHYYLGDADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtgcgacacggcgaaagccagtggaacaacgaaaac
cgcttcaccggatggtatgatgtagacctttctgacaagggccgtaccgaagctaaagca
gccggacagctgctgaagaaagaaggtttcgtgtttgatttcgcctacacctctgtgctg
aaacgcgccattcacaccctgtggaatgtgctggatgagctggatcaggcctggctgccc
gttgagaaatcctggcgtctgaacgaacgtcactatggcgcgctgcagggcctggacaaa
gctgaaaccgccgcaaaatacggcgacgagcaggttaaacagtggcgtcgtggcttcgcg
gtgactccgccagagttggaccgcagcgatgagcgttttcctggacacgacccgcgttat
gcttcactgaagcctgagcagctgcccaccaccgaaagcttggcgctgaccatcgaacgc
gtgatcccttactggaacgaatccattctgccacgtatcaaaagtggtgagaaagtgatc
gtggcggcccacggtaactcactgcgtgcgctggtgaaatacctggacaacatgagcgaa
gaagagattcttgaactgaatatcccgaccggcgttccgctggtgtacgagttcgatgaa
aacttcaaaccgatcaaacattactacctgggtgatgctgacgagatcgcagcgaaagcc
gcggccgttgccaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system