KEGG   Pantoea ananatis AJ13355: PAJ_0925Help
Entry
PAJ_0925          CDS       T01969                                 

Definition
(GenBank) putative amidase protein hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00970  Aminoacyl-tRNA biosynthesis
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PAJ_0925
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:paj03029]
    PAJ_0925
Enzymes [BR:paj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PAJ_0925
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PAJ_0925
Mitochondrial biogenesis [BR:paj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PAJ_0925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAK11005
UniProt: A0A0H3KZD2
Position
complement(1102978..1104387)
Genome map
AA seq 469 aa AA seqDB search
MSKEIYYSDATHLASMIRNRDVSPVEVMQAHLDRIAATNPDVNAVVTVAEDALKQAAAAE
AAVMKGEKLGPLHGVPFTVKDSIDTAGVLTQRGSPIFKGRRPDEDATSVARLKKAGGILL
AKTNLPEFSYWIESDNLLSGRSNNPWDLTRTPGGSSGGESAAIAAGMSPLGLGTDLAISV
RGPAAQTGITSMKATHGSVPMTGIWPRAPRRFWHVGPMARSVRDIALAFSQLSGPDGHDA
FSSAAPVHSDGLPFVASRPLRIGWMTGPGFGPVDPDVNAIVKAAAEALKAPGVVVEHVGI
PALEKDFALDVFNRLHVMEMKPAFAAATAGRQPDEIYKMAKTMLSLPDTSMSAYIDAEQA
AERLRDGFAEYFSRYDALITHVLPIPAHKHGVDRFVIDGQEVDATYLQGATVPLNVTGLP
GVALPFGKSREGLPVNVQIVGKWHDEHVILHIASLLEAVSPVKGSHPSL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagaaatttattactcagacgcgactcacctggccagcatgatccgtaaccgc
gacgtttctcccgttgaggtgatgcaagcgcatcttgatcggattgccgccactaacccg
gacgtcaatgctgttgtaacagtggcagaggatgccctgaagcaggctgccgctgccgaa
gccgccgtgatgaagggtgagaaactgggcccgcttcacggcgttccttttaccgtaaag
gactccatcgatacggcaggtgtgctgactcagcgtggttcacctattttcaaaggccgt
cgtcctgacgaagacgcaaccagcgtggcgcgtcttaaaaaagcaggcggcatcctgctg
gctaagacgaacctgccggaattttcatactggattgaaagcgacaacctgctgtccggg
cgctctaataacccatgggacctgacccggacgcccggcggctccagtggcggtgagtct
gccgcgattgccgcaggcatgtctccgctgggactgggcacggatttggccatctcggta
cgaggccctgcggcgcagaccggcatcacttccatgaaagccacgcacggcagcgtgccc
atgacaggcatctggccgcgtgcgccccgccgcttctggcatgttggccctatggcccgc
tcagttcgcgatattgccctggcattctcgcagctttcgggaccagatggtcacgacgca
ttctccagcgctgcgcccgttcattctgacgggctgccgtttgtagcatcgcgtccgctg
cgaattggctggatgaccggcccgggctttggtccggttgatccggacgttaacgccatc
gtgaaggcggctgcggaagcgctaaaagcaccgggcgtcgttgtggagcatgtcggcatt
cctgcactggagaaagactttgcgctggatgtgtttaaccggctccacgtcatggaaatg
aagcccgcctttgcggcggccacggccggtcgccagcctgatgagatctacaaaatggcg
aaaaccatgctgtcgttacctgatacatcgatgtctgcttatattgatgcagagcaggcc
gccgaacgattgcgtgacggcttcgcggaatacttttcacgctacgatgcgcttatcacg
catgtactccccatcccggcgcataaacacggcgtggataggtttgttattgacggtcag
gaagttgatgccacttatctgcaaggtgccacggtgccgcttaacgtcacagggttgcct
ggtgtagcgttgccgtttggtaagagtcgtgaaggcttgccggttaacgtgcagatcgtc
ggcaaatggcatgatgagcacgtcattctccatattgcctctctgctggaagcagtgagc
cctgtgaaaggttctcatccgtcactgtaa

DBGET integrated database retrieval system