KEGG   Pantoea ananatis AJ13355: PAJ_0968Help
Entry
PAJ_0968          CDS       T01969                                 

Gene name
gpo
Definition
(GenBank) glutathione peroxidase Gpo
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00480  Glutathione metabolism
paj00590  Arachidonic acid metabolism
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PAJ_0968 (gpo)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PAJ_0968 (gpo)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PAJ_0968 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: BAK11048
UniProt: A0A0H3KVH9
Position
complement(1157348..1157830)
Genome map
AA seq 160 aa AA seqDB search
MTTFHQLNATSLNGQHISMADYAGKLVLVVNTASHCGFTPQYAGLEALYKKYAAQGLVVL
GFPCNQFGKQEPGSADDIAQTCHIHYGVSFPMFEKVEVNGPGTHPLFRYLKAELPGVLGE
RIKWNFTKFLIGRDGKPLKRFTPIATPEKMEATLLAALES
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttttcatcaactcaacgccaccagcctgaatggccagcacatctcgatggcc
gactatgctggcaagctggttctggtggtgaataccgccagccattgtggattcactcca
caatatgcaggtcttgaagcactctacaaaaagtacgctgcgcaggggctggtggtactg
ggtttcccttgcaaccagttcggtaagcaggaaccgggcagtgccgacgacatcgcgcag
acctgtcacattcactacggtgtgagcttccccatgttcgaaaaagtagaggttaacggc
cccggaacgcatccgctatttcgttacctgaaagcggagttacccggtgtgctgggtgag
cggattaaatggaacttcactaagtttttgatcggacgcgacggcaaaccactcaagcgt
tttacacccatcgctacgccggaaaaaatggaagccaccctcctggcggcacttgaaagc
taa

DBGET integrated database retrieval system