KEGG   Pantoea ananatis AJ13355: PAJ_1391Help
Entry
PAJ_1391          CDS       T01969                                 

Gene name
trpC
Definition
(GenBank) tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
paj01100  Metabolic pathways
paj01110  Biosynthesis of secondary metabolites
paj01130  Biosynthesis of antibiotics
paj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAJ_1391 (trpC)
Enzymes [BR:paj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PAJ_1391 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     PAJ_1391 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C HHH_4
Motif
Other DBs
NCBI-ProteinID: BAK11471
UniProt: A0A0H3KWP5
Position
1686170..1687531
Genome map
AA seq 453 aa AA seqDB search
MQGTVLDKIVKDKAVWVEARKQQQPLESFQQRVALSSRSFYDALQGTRTAFILECKKASP
SKGLIRDDFDPEMIAGVYRHYASAVSVLTDEKYFQGDFAFLPVVSAAITQPVLCKDFIID
PYQIYLARYYQADAILLMLSVVDDEQYRQLAAIAHSLQMGVLTEVSNEQELERAIALEAK
VVGINNRDLRDLSIDLNRTRELAPRLGPGVTVISESGINNYRDVRELSHFANGFLIGSAL
MEEEDLHAAVRRVTLGSNKVCGLTRPEDACAACEAGAIFGGLIFVEGSPRQVDTERARAV
MAGAPLKYVGVFRDAAISDIVTKTEALQLSAVQLHGDEDPAYVAELYQALPENVQIWKAL
SIQTALPERRWPHVDRYVFDNGNGGSGQTFDWSLLKGQDLKNVLLAGGLSADNCVEAAQL
GCAGLDFNSGVESEPGIKDASKIASVFRTLRAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcagggtacagtgttagataaaatcgtgaaagacaaagccgtttgggttgaggcgcgt
aagcagcagcaacctctggagagtttccagcagcgagtggcgctttccagccgtagtttt
tatgacgcactgcagggcacccgcactgcctttattctggaatgcaaaaaagcctctcca
tccaaagggcttattcgtgatgattttgatcctgagatgatagccggggtttatcgccac
tatgcctctgccgtttccgtattaacggacgagaaatactttcagggtgacttcgccttt
ttgcccgtcgtcagcgcggccattacgcagccggtcctgtgcaaagattttattatcgat
ccgtatcaaatttacctggcgcgttactaccaggcggatgccatcctgctgatgctctct
gtggttgacgacgagcagtatcgccagctggccgccattgcgcacagcctgcagatgggc
gtcctgactgaagtcagtaacgagcaggagctggaacgcgcgattgcgctggaagccaaa
gtggtcggcatcaacaaccgtgacttacgcgatctctccatcgaccttaaccggacccgt
gaactggccccgcgcctgggccccggcgtcaccgtgatcagtgagtcgggcatcaacaac
taccgggatgtccgcgagttaagccactttgcgaatggtttcctcatcggctctgcgcta
atggaagaagaggatcttcatgccgccgtgcgccgcgtcaccttaggcagcaataaagtc
tgcggtctgacccgtcctgaagacgcctgcgcggcctgcgaggcaggtgccatttttggt
ggtttgatctttgttgaaggttcgccgcgtcaggttgataccgagcgtgcacgcgcggtc
atggctggcgcaccgctaaagtatgttggcgtgttccgtgatgccgctataagtgacatt
gtcacaaaaacagaggcgttacagctgagtgccgtgcaactgcatggcgatgaagacccg
gcctatgtggctgagctttatcaggcgctgccagaaaacgtgcaaatctggaaagcgctc
agcatccagacggccctgcccgaacgtcgctggccccatgttgaccgctatgtcttcgat
aacggcaacggaggctcgggccagacatttgactggtcgctgctaaaaggacaggacctg
aagaatgttctgctggcaggaggactgagcgctgacaactgcgtcgaagccgctcagtta
ggctgtgcagggctggatttcaattcgggcgtggaaagcgagccgggtattaaagacgcc
agcaaaattgcctcggtattccggacgcttcgcgcctactga

DBGET integrated database retrieval system