KEGG   Pantoea ananatis AJ13355: PAJ_1468Help
Entry
PAJ_1468          CDS       T01969                                 

Gene name
rrmA
Definition
(GenBank) ribosomal RNA large subunit methyltransferase A RrmA
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:paj03009]
    PAJ_1468 (rrmA)
Enzymes [BR:paj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     PAJ_1468 (rrmA)
Ribosome biogenesis [BR:paj03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PAJ_1468 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Ubie_methyltran MTS Methyltransf_23 Methyltransf_32 Methyltransf_12 PCMT PrmA Methyltransf_29 Methyltransf_4 FtsJ MetW Methyltransf_3 Methyltransf_9 DUF938
Motif
Other DBs
NCBI-ProteinID: BAK11548
UniProt: A0A0H3KWV6
Position
complement(1768040..1768849)
Genome map
AA seq 269 aa AA seqDB search
MSLNCPLCHFPLTLTDRSWRCENRHQFDQAKEGYVNLLPVQHKGSREPGDSADMMQARRA
FLQAGHYQPLRDNVVAVLNQHLNQPAAQILDIGCGEGYYTGALASELAPEGQVYGLDVAK
MAVRLAAKRYAQVLFCVASSHRLPFGDASLDAVVRIYAPCNETELSRVIKPGGFLLTVTP
GPHHLQQLKALIYRDVQLHASEEKSYQGFRQLAQHRLTYPMTLSGQSATTLLQMTPFAWR
ARPDVWQSLAESTQFPCDADFMITLWQRD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgaactgcccactttgtcacttccccctgaccctgactgaccgcagctggcgc
tgtgaaaatcgccatcagttcgatcaggcgaaagagggctacgtcaatttgctgcccgtt
caacataaaggttcacgtgaaccgggcgacagtgcagacatgatgcaggcgcgacgtgcg
tttctgcaggccggtcactaccagcctttgcgggacaacgtggttgccgtccttaaccag
catctgaaccaaccggctgcgcagattctggatatcggctgtggagaaggctactacacg
ggcgcactggccagcgagctcgcgcctgagggccaggtttatggtctggatgtggcgaag
atggccgtcaggctggcggcaaagcgttacgcccaggttttattttgcgtggcatcaagc
caccgcctgccgtttggtgatgcttcgctggatgcggtggtccgcatttatgcgccctgt
aacgagactgagctcagccgggtcattaaaccgggaggctttttactcacggtcacgccc
gggcctcatcatcttcagcagcttaaggcgctgatataccgcgacgttcaactccacgcc
tcggaagagaaaagctaccagggatttcgtcaactcgcccagcatcgtttaacgtatcca
atgacgttgagcgggcagtctgccaccaccttgttgcagatgacgccctttgcctggcgc
gcgcgacctgatgtgtggcagagcttagcggaaagtacgcagtttccctgcgacgcagac
tttatgatcaccctgtggcaacgcgattag

DBGET integrated database retrieval system