KEGG   Pantoea ananatis AJ13355: PAJ_1647
Entry
PAJ_1647          CDS       T01969                                 

Definition
(GenBank) hypothetical protein
Organism
paj  Pantoea ananatis AJ13355
SSDB
Other DBs
NCBI-ProteinID: BAK11727
UniProt: A0A0H3L4G9
Position
complement(1986824..1987672)
AA seq 282 aa
MFINRLFSSLLFVAVLMLVSCLARAESTAETVTAALNEGDFSVLLNDYAFTPGDAWNNQS
FIRAGKALSSVVAGEVVINEQRYNYYQHTYEGFQLFSATAVGNASHAILAEILLDGASVP
TARNIIVGDSVEQVQKAYGPGKEDNSDNQHWLIYKMGEKQLMFEIDQQKVSHIMLNTTMS
AEQHEVSADQAIALATNAIHTYHLTALDDQCLRYDLDDTSEKAFYIITVREDNHDVSCGG
DPDISPRLFDIKVARDNTQILTNADNADGDYRSLVPPATNNQ
NT seq 849 nt   +upstreamnt  +downstreamnt
atgttcataaatcgtcttttcagcagtttattgtttgtggctgtccttatgttggtatcg
tgccttgccagggctgaatccactgcagaaaccgtaactgccgctttaaatgagggagat
ttctcggtcctgctcaacgactacgctttcacccccggcgacgcatggaacaaccaaagc
ttcatacgggcaggcaaagccctgagttccgttgtggccggagaagtcgtcatcaatgag
cagcggtacaactattaccaacatacctatgaaggctttcagttattcagcgcgacggcg
gtaggaaacgccagccatgcaattctggcagagatcctattggacggtgccagcgtgccg
acggctcgtaacataatcgtcggcgatagcgtggaacaggttcagaaagcctacggaccc
ggaaaagaagataacagtgataatcagcactggcttatctataagatgggtgagaagcag
ttgatgttcgaaattgaccagcaaaaagtcagccacatcatgttgaataccaccatgagt
gcagagcaacatgaagtcagcgctgatcaggctatcgccttagcgacgaacgcgattcat
acttatcacctcaccgcgcttgatgatcaatgtctgagatacgacctggatgacaccagc
gagaaggcgttctacatcatcacggttcgtgaagacaaccatgacgtcagttgcggcggg
gacccggatatttctccccggctttttgatatcaaagttgctcgtgataacacacagata
ctcacaaatgccgataacgcggatggcgattatcgtagcctggttccacccgccacaaac
aatcaataa

DBGET integrated database retrieval system