KEGG   Pantoea ananatis AJ13355: PAJ_1649
Entry
PAJ_1649          CDS       T01969                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAJ_1649
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paj02044]
    PAJ_1649
Secretion system [BR:paj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAJ_1649
SSDB
Motif
Pfam: Glucosaminidase Phage_base_V Phage_GPD Gp5_C
Other DBs
NCBI-ProteinID: BAK11729
UniProt: A0A0H3KX14
Position
complement(1989056..1990684)
AA seq 542 aa
MVSGSGTATGIAPGYTFALLNAPHFSDNGKYLVTSAHYDFEENSYASGDVGATRHNIDFT
VLPAAVTYRAKPETPWPKTHGPQTAKVVGPKGESIWTDKYGRVKVKFHWDRLAKGDDTSS
CWVRVSSAWAGQGFGGVQIPRVNDEVVVDFINGDPDRPLIIGRVYNEASMPPWALPAAAT
QMGFLSRSKDGTADTANALRFEDKAGEEHLWIQAQKNMDTHVKNDSSHSVANNHSHYAGG
NELYRVETNRVHGVKGGEERLTGQGKIDNVVDTYVLGSGTKLRLECGESAIELNANGHIN
IVGKGFNLFVNGDGHITTSGGKLNLNTSGAQPGTGAPGAGHKGNINQAVVNLFPPKQKGQ
AAPAAPKAKVEHAKSPSTPVNNKTEKKVRPLPPEKQAFFDKVYAAAQADEKKTGVPAQVT
TAQAILESDWGKRVPTDVNTNKVSNNLFGVKAHGSPNYVESWTHENINGKRVPVLDKFAS
YDSVDESIEQHSQFLIKNQRYSSLFQSSDPVEWAKGLQDKGYATDPNYAKSLISVMKGRG
LL
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggtgagcgggagcggcacggcgacgggcatcgcgccgggctacactttcgcgctgctg
aacgcaccgcacttcagcgacaacggcaaatacctggtgacgtcggcgcactacgacttt
gaagagaacagctacgcgagcggcgacgtgggcgccacgcggcacaacatcgacttcacg
gtgctgccggcggcggtgacgtaccgtgcgaagccggagacgccgtggccgaagacacac
ggcccgcagacggcgaaggtggtggggccgaaaggcgagagtatctggacggacaaatac
ggccgggtgaaggtgaagttccactgggaccgtctggcgaagggcgacgacacgagttcg
tgctgggtgcgcgtatcgagtgcctgggcgggccagggcttcggcggggtgcagatcccg
cgcgtcaacgatgaggtcgtcgtggacttcatcaacggcgatccagaccgtccgttgatc
attggccgcgtttataacgaagccagtatgccgccatgggcactaccggctgccgccaca
caaatgggctttctgagtcgctcgaaagacggcactgcggataccgcgaacgcattacgc
tttgaggataaggcgggcgaggagcatttgtggatccaggcgcagaagaacatggatacg
catgttaaaaatgattccagccattccgttgccaacaaccacagccactatgcaggcggt
aacgaactctatcgcgttgaaaccaaccgtgtacatggcgtgaaaggtggagaagagcgt
ttaacgggacaagggaaaatcgacaatgttgttgatacctatgtactgggctcaggtact
aagttacggcttgaatgtggcgaaagcgctattgaacttaatgctaatggtcatatcaat
attgtcggtaagggcttcaatctgtttgtaaacggtgatggacacatcactacatcaggc
ggaaaacttaatttaaatacatccggtgcgcagccgggtacgggtgcacctggtgctggc
cacaaaggcaacatcaatcaggccgttgtgaatcttttccccccaaagcaaaaggggcag
gcggccccggcagcacctaaagcgaaggttgagcatgcgaaatccccttccacaccagta
aacaataaaactgaaaagaaagtgcggccgttacctcccgaaaaacaagccttttttgat
aaggtgtacgccgcagctcaagctgatgagaaaaagacaggcgtccctgcacaggtaaca
actgctcaagccatattggaatctgactggggaaagagagtgccgactgacgttaatacc
aataaggtcagtaataatctttttggggtaaaagcacacggctcgccaaattatgtggaa
tcatggactcatgaaaacataaatggcaaacgagtacctgttttagacaaattcgcgagt
tatgactcagtagatgaaagtattgaacagcattctcaatttttgattaaaaatcagagg
tatagtagtttgtttcagtcatcggatcctgttgagtgggccaaaggattacaggataaa
ggctatgcaacggatcccaactatgctaaaagcttgatttcagtaatgaaaggtagaggc
ctcctatga

DBGET integrated database retrieval system