KEGG   Pantoea ananatis AJ13355: PAJ_1650
Entry
PAJ_1650          CDS       T01969                                 

Definition
(GenBank) Rhs element Vgr protein
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: Phage_GPD bCoV_SUD_C
Other DBs
NCBI-ProteinID: BAK11730
UniProt: A0A0H3L1I7
Position
complement(1990563..1991252)
AA seq 229 aa
MKRDRNLRIFQSQTVPQIVQTLLKEYGVNVETRLAGSYRVWEYCVQYQESSFDFISRLME
LEGMYYFFRHEADKHTLVLCDAPDQHQAFPGYETIAYHVTPSGGSVTEEGVSQWALSESV
TPGMYSTDDYDFRKPNAWMLQARQNPVSPTPGVRWTVYRLARVSFSGSTGHRQNTTQQYP
PGGVAGGAPHGERERHGDGHRAGLHFRAAERTALQRQRQIPGDVGALRL
NT seq 690 nt   +upstreamnt  +downstreamnt
atgaagcgcgaccgcaacctgcgcatcttccagagccagacggtgccgcagattgtgcag
acgctgctgaaggagtacggagtgaacgtggaaacgcgcctggcgggaagctaccgggtg
tgggaatactgcgtgcagtatcaggagagcagcttcgactttatcagccggctgatggag
ctggaggggatgtactacttcttccggcacgaggcggacaagcacacgctggtgctgtgc
gacgcgccggaccagcaccaggcgttcccgggctacgagacgatagcctaccacgtgacg
ccgtcgggcggcagcgtgacggaagagggcgtgagccagtgggcgctgtcggaaagcgtg
acgccggggatgtacagcacggacgactacgacttccgcaagccgaacgcgtggatgctg
caggcgcggcagaacccggtgtcgccgaccccaggggtcaggtggacagtgtacagactg
gccagggtcagcttcagtggaagcacaggtcacaggcagaatactacgcagcagtatccg
ccaggaggtgtggcaggtggagcaccacatggtgagcgggagcggcacggcgacgggcat
cgcgccgggctacactttcgcgctgctgaacgcaccgcacttcagcgacaacggcaaata
cctggtgacgtcggcgcactacgactttga

DBGET integrated database retrieval system