KEGG   Pantoea ananatis AJ13355: PAJ_1651
Entry
PAJ_1651          CDS       T01969                                 

Definition
(GenBank) hypothetical protein
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: DUF3540 G8 HA
Other DBs
NCBI-ProteinID: BAK11731
UniProt: A0A0H3KXE3
Position
complement(1992009..1992614)
AA seq 201 aa
MNNVNHTLAKAILPPVQAAGVVTHCFVDGSLTVECEGRGWHCRRAASCVIVPQTGDTVLV
TSVENQIWLLAVLERSNPQKAELSVPGDLHINSAGELSLSSAALRVSAEQGDCHINEMNY
SGDKLSAWVSLSRIVGKRAESVWQTITQISHNLLRTTHNTEQVRAGQLDMKAEDYARLHA
HNTVITSKAITKVDSEQIHMG
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaataatgtcaatcatacgctggcaaaagccattttaccgccggtgcaggccgcgggt
gttgtcacgcactgcttcgtcgatggcagcctgacagttgaatgtgaagggcgaggctgg
cattgtcgccgggcagcaagttgcgtcattgtgccgcaaacgggtgacacagtattagtc
accagcgtcgaaaaccagatttggctactggccgtgctggagcgtagtaatccgcaaaag
gccgaactcagcgtaccgggcgatttacatattaatagcgccggtgagctgagcttaagc
agtgctgcgctgcgcgtcagcgctgagcaaggggattgccatatcaacgagatgaattac
agtggtgacaaactctctgcctgggtcagtctttcacgtatcgtgggcaaacgtgcagag
tccgtatggcaaaccatcacgcagattagccataacctgctgcgtaccacgcataacaca
gagcaggtccgtgccgggcaactggatatgaaagccgaggattacgcgcgtttgcacgct
cacaatacggtaatcacctcgaaagcgataaccaaagtggattctgaacagattcatatg
ggttaa

DBGET integrated database retrieval system