KEGG   Pantoea ananatis AJ13355: PAJ_1652
Entry
PAJ_1652          CDS       T01969                                 

Definition
(GenBank) hypothetical protein
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: Pentapeptide Pentapeptide_4 Pentapeptide_3 LRR_5 SurA_N_3
Other DBs
NCBI-ProteinID: BAK11732
UniProt: A0A0H3L4H4
Position
complement(1992627..1993697)
AA seq 356 aa
MTALTPAELHRRIKQGEVVSELNLNGLNLQGYDLSGGIFQDVSLTGANLQGANLKETVFT
ECELDQADLRQAIIEQSVFNQCEMSGLMADETSLSETVFNQCALTNSSFARSTLLSTQFM
QCPLAQAQFKQAQFDRCVFFESVLDGTDFEGCKSLLTTFYSIDLRQTVLSAGEFERTVFF
KCDQREKNYAQQRFIGCQFMDCALDKALFNGAQLSQCNFKGASLKAAQLNQVNASQALFM
EADLTGAQCKGSLFDQAIFVGAMLERTDFTGSRFFQSILHQVKASQALFIRCDLTYSDFT
AADIRMADLRSATFSRTRMHRARQENAQFSGRQGILEFDEELLAAEAWSAQRQSRS
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgacagcgctcactccagcggagctgcatcggcgaatcaaacaaggtgaggtcgtcagc
gagttaaacctgaatggcctcaatctgcagggatatgatctttctggtgggatctttcag
gacgtgtccttaacaggggcgaatctgcagggtgccaatttaaaagaaacggtttttact
gaatgtgagcttgaccaggctgatttgcgccaggcaataattgagcagagtgtctttaac
cagtgcgaaatgtcggggttaatggcagatgagacaagcctgagcgaaaccgtatttaac
cagtgtgcgcttaccaatagcagttttgcgcgtagcaccttgctaagcacgcagtttatg
caatgcccgctcgcgcaagctcagtttaaacaggcacagtttgatcgctgcgtctttttt
gaatcagtgctggatggaacagactttgagggctgcaaaagtctgctgacgaccttttac
agcattgacctacgccagacagtcctgagtgcgggtgagtttgaacgcactgtatttttt
aaatgcgaccaacgcgaaaagaattatgcacagcaacggtttattggttgccagttcatg
gactgcgcgctggataaagcgctgtttaatggtgctcaactttcgcaatgcaattttaaa
ggcgcttcgcttaaagccgctcagcttaatcaggtaaacgccagccaggcgctgttcatg
gaagccgatctcactggagcacaatgcaaaggaagcctgtttgatcaggccattttcgtt
ggtgccatgcttgagcgcactgattttacaggcagccgttttttccagagcatcctgcac
caggtaaaggcctctcaggcgctcttcattcgctgcgacctgacatacagcgactttacc
gcagccgatatcagaatggcagacctacgcagtgcaaccttttcccgaacgcgcatgcac
cgggcgcgccaggagaacgcgcagttctctggtcgtcagggcattcttgaatttgatgaa
gaattactggcagctgaagcctggagcgcgcagcgccagagccgcagttga

DBGET integrated database retrieval system