KEGG   Pantoea ananatis AJ13355: PAJ_1653
Entry
PAJ_1653          CDS       T01969                                 

Definition
(GenBank) hypothetical protein
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: DUF2169 Pentapeptide Pentapeptide_4 Pentapeptide_3 CfAFP
Other DBs
NCBI-ProteinID: BAK11733
UniProt: A0A0H3KXC5
Position
complement(1993694..1996234)
AA seq 846 aa
MKIIKPLRLSVLNRPYRWQGKNHLGVTVLALADMSDNPKLRPEMELWQLAASELQTSGGV
LDLAMPKVCAEFLATGNAYTHHQSDKTACAAKIEVDTLSKSLAVFGDRYWVGNNITAPQP
FEEMRLDWSRAFGGEGHDDNPYGIGIHPEIHQGHEFVRLPNIEAMSGRLTQPKQKPEPAG
FGPLDISWPRRFSRMGKKYDSSWLQNDFPGFARDIDWKVFNAASPDQWWADRDTLPEQAA
WRIWNMHPQKPVQEGKLPPWQARCFINRQREDETLFEEISLRATTVWFFPHLEQMVLLWQ
GNTRINEDDAADVLQLMPALERRGSPRSVNHYRKVLTQRLDKESGALFSFREKDLIPDDT
IGPWIDNQVEQTPSPMRDNMQTRAKLLREQHRARIEASGGDIGDLLNEPDEPELPKLEDL
PEFIEKMERQAEEMKAQAEQRKRDIEARYPQNEGDEHQPRGPETLFRMQEMLQRNKASLS
EKKLAQMRDALHQMYLMSVNSQPPALRLKGDLAQIIRQRAERTLAQGGNFSGMDLTGADF
SGMDLRGADFSKTLLECADLSHCQLDGANFNSAMLARTELHHSSLRNCNFERASFALAQC
CQSDFSGSYFKDTQLQETLFDNCTFNEATFSELLFRETWFTQCRFQRAILQACVFMELDL
PGLDFTEAKLSKTTFIKSTLEQAVFNRAELESCSWVETQADHATFSGSIWLTCAVASGSS
LNDADFTHATLRQSNLRQTPLNAAVFTQAKLDNSDLSEASCKGANFQQANLAGSLFVRTD
FRDADFTDANLMGAILQKSQLGGACFRGTTLFRADLSQAFTSETTELDGAFTKRIKTLPK
RDGEIV
NT seq 2541 nt   +upstreamnt  +downstreamnt
atgaaaattattaaacctctccgcctgagcgtacttaatcgtccatatcgctggcagggt
aaaaaccatcttggcgtcaccgtgctggcattagccgatatgagtgataacccgaagctc
cgcccggaaatggaactgtggcaactcgccgccagcgaattacaaaccagcggcggcgtc
ctcgatttagccatgccgaaagtgtgtgctgaatttctggcgacgggcaatgcctacacg
catcatcaaagcgataaaaccgcctgcgcagcaaagattgaagtcgatacgctaagcaag
tcgctggcggtatttggcgatcgctactgggttggaaataacatcacagcgccgcagccc
tttgaagaaatgcgactggactggagccgggcttttggcggcgaagggcacgatgacaat
ccctatggcattggcattcatcccgaaatacatcagggccatgagttcgtccgcttacct
aacatcgaagcgatgagcggacgtcttacgcagcctaaacaaaagcctgaacctgctgga
tttggtccgctggatattagctggccacgacgttttagtcgtatgggaaaaaaatacgat
tccagttggttacaaaatgattttcccggttttgcgcgcgatatcgactggaaagtcttt
aatgctgccagtcctgatcaatggtgggcagatcgcgataccttacctgaacaagccgcc
tggcgaatctggaatatgcatccgcaaaagccggtgcaggagggcaaactccctccctgg
caggcacgctgctttattaatcgtcagcgcgaagatgaaacactgtttgaggaaatttca
ctgcgggcaaccacggtgtggttctttcctcatctggagcaaatggttctgttatggcaa
gggaacacgcgcatcaatgaagatgacgcggctgatgtcttgcagttgatgcccgcgctc
gaaagacggggttcgccgcgctcggtcaaccattaccgcaaggtgctcacgcaacgcctg
gacaaggaaagcggggcgctcttttcattccgcgaaaaggatcttattccagatgacacg
atcggcccctggattgataaccaggttgagcaaacgcccagtccgatgcgggataatatg
caaacgcgggcaaaacttcttcgtgagcagcaccgtgcgcgtattgaggcatccggtgga
gatataggtgacttactcaacgaacccgatgagccagaactgccgaagctggaagacctg
ccggagtttatcgaaaaaatggagcgccaggctgaggagatgaaggcacaggcagagcaa
cgtaaacgcgatattgaggctcgttatccgcaaaatgaaggtgacgaacatcagccgcgt
ggtccggaaacgctttttcgtatgcaggaaatgctccagcgcaacaaagcgagcttaagt
gagaaaaagctggcacagatgcgtgatgctcttcatcaaatgtacctcatgtccgtcaac
agtcagccacccgccctgcgcctgaagggcgacctggcacagatcattcgtcaacgtgcg
gaaaggacgcttgctcagggtggaaactttagtggcatggatctgaccggcgcggacttt
tcgggtatggatcttcgcggtgccgactttagtaagacgctgctggaatgtgccgattta
agtcactgccaactggacggggccaatttcaacagcgcaatgttggcgcgaaccgaattg
caccatagttcgctacgcaactgtaattttgaacgtgccagctttgctttagcccagtgt
tgccaaagtgatttctcgggttcgtactttaaagatacacagttgcaagaaacgcttttc
gataactgtacctttaatgaagcgaccttcagtgaattattgttccgggaaacctggttt
acccaatgccgttttcagcgcgccatccttcaggcttgcgtgtttatggaactcgatttg
ccgggtcttgattttacagaggcgaaactcagtaaaacgacatttataaaatccacactg
gaacaggctgtttttaaccgtgccgaattagagagctgctcatgggtggaaacgcaggct
gaccatgcaactttcagcggctcaatctggttgacctgtgcggtggcttccggcagttcc
cttaatgatgcagatttcacgcacgccacgctgcgacaaagtaatctgcgccagacaccc
cttaacgctgcggtgtttacccaggcaaaactggataacagtgatttgagtgaggcaagc
tgtaaaggggctaattttcagcaagcgaacctggcaggcagcctgtttgtgcgcacggat
tttcgcgatgcagacttcactgatgccaatctgatgggcgcgatattgcaaaaaagccag
ttaggtggggcatgtttccggggcacgacgctttttcgcgccgatctgtctcaggctttt
acaagcgaaaccacggaacttgatggcgcctttacaaagcgtatcaaaacgttgccgaag
cgtgatggagaaattgtatga

DBGET integrated database retrieval system