KEGG   Pantoea ananatis AJ13355: PAJ_1654
Entry
PAJ_1654          CDS       T01969                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAJ_1654
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paj02044]
    PAJ_1654
Secretion system [BR:paj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAJ_1654
SSDB
Motif
Pfam: Phage_GPD Phage_base_V bCoV_SUD_C Gp5_C
Other DBs
NCBI-ProteinID: BAK11734
UniProt: A0A0H3KX19
Position
complement(1998701..2000764)
AA seq 687 aa
MSMFSRITVQLPAQGLLFRRLSGSEALSQSFVLQAELLSTDARIDRKSLLGKPVTFTLPT
DGLLSAVNPRYINGKITQIGVRSEELGGVRYAVYGLTVESDLWPMKRDRNLRIFQSQTVP
QIVQTLLKEYGVNVETRLAGSYRVWEYCVQYQESSFDFISRLMELEGMYYFFRHEADKHT
LVLCDAPDQHQPFPGYETIAYHVTPSGGSVTEEGVSQWALSESVTPGMYSTDDYDFRKPN
AWMLQARQNPVSPTPGSVDVYDWPGRFVEHGHGEYYARIRQEVWQVEHHMVSGSGTATGI
APGYTFSLLNAPHFSDNGKYLVTSAHYDFEENSYASGDAGATRHNIDFTVLPAAVTYRAK
PETPWPRTHGPQTAKVVGPKGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAG
QGFGGVQIPRVGDEVVVDFINGDPDRPIVTGRVYNEASMPPWDLPGDATRMGFMTRSKDG
HQANASYLFFEDKPGGELLNMHAEKDMNISVENDKTVAIDGSRTTTIGKEQNDEVTGDAT
FHYKQKRTTTVDQLESNIFNNGESTEIKNGRKLNLKSGGDESNITGGQKLNLNGTREVTI
SNGDILNVQAEGRKQHINGNVEEEINGNVGVNINGNWTQTVEGGTAFISSPNLIRIQSAT
KVEIDSPQGLYTNKGLNVSFNGASNVI
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgtctatgttctcacgtattactgtacaacttcccgcacaaggactgctgttccgacgt
ctgagcggcagcgaagcgctgtcccagtcgttcgtgctgcaagcggagctgctctccacc
gacgcgcgcattgatcgtaagtcgttgctgggcaagccggtcactttcacgctgccgacg
gacggtctgctgagcgcggtgaacccgcgctacatcaacggcaaaattacgcagataggc
gtgcgcagcgaggagctgggcggcgtgcgctacgcggtgtacgggctgacggtggagtcg
gatctgtggccgatgaagcgcgaccgcaacctgcgcatcttccagagccagacggtgccg
cagattgtgcagacgctgctgaaggagtacggagtgaacgtggaaacgcgcctggcggga
agctaccgggtgtgggaatactgcgtgcagtatcaggagagcagcttcgactttatcagc
cggctgatggagctggaggggatgtactacttcttccggcacgaggcggacaagcacacg
ctggtgctgtgcgacgccccggaccagcaccagccgttcccgggttacgagacgatagcc
taccacgtgacgccgtcgggcggcagcgtgacggaagagggcgtgagccagtgggcgctg
tcggaaagcgtgacgccggggatgtacagcacggacgactacgacttccgcaagccgaac
gcgtggatgctgcaggcgcggcagaacccggtgtcgccgaccccggggtcggtggacgtg
tacgactggccgggtcgcttcgtggagcacggtcacggcgaatactacgcgcgtatccgc
caggaggtgtggcaggtcgagcaccacatggtgagcgggagcggcacggcgacgggcatc
gcgccggggtacaccttttcgctgctgaacgcgccgcacttcagcgacaacggcaaatac
ctggtgacgtcggcgcactacgactttgaagagaacagctacgcgagcggcgacgcgggc
gccacgcggcacaacatcgacttcacggtgctgccggcggcggttacttaccgtgcgaag
ccggagacgccgtggccgaggacgcacggcccgcagacggcgaaggtggtggggccgaaa
ggcgagagcatctggacggacaaatacggccgggtgaaggtgaagttccactgggaccgt
ctggcgaagggcgacgacacgagttcgtgctgggtgcgcgtatcgagcgcctgggcgggc
cagggcttcggcggggtgcagatcccgcgcgtgggcgatgaggtcgtcgtcgattttatc
aacggcgatccggaccggccaatcgtcaccgggcgtgtctacaacgaagccagcatgcca
ccctgggatctccccggcgatgctacacgaatgggctttatgacacggagtaaagacgga
catcaggccaatgccagctatctgttctttgaagataagccgggcggtgaactgctgaat
atgcatgctgagaaagacatgaatatttcggtggagaatgataagaccgttgccattgat
ggatcccggactaccactattggaaaagagcagaatgacgaagtaacaggtgatgcgact
tttcattataaacagaagcggactactacggttgaccaacttgagtcgaatatattcaat
aatggtgaaagtacagagattaaaaacgggcgaaagctaaatttaaaaagtggaggcgac
gagagcaatattacgggtggacaaaaactcaatcttaacggcactagggaagtcactata
tcaaacggtgatatccttaatgttcaggctgaggggcggaagcaacatataaatggcaat
gttgaggaggaaataaatggcaatgtcggagtgaatataaatggcaactggactcagacg
gttgaaggcgggactgcatttatctcatctccaaatttaataagaattcaaagtgcgaca
aaggtagaaattgattcaccgcaagggctttatactaataaaggtttaaatgtctctttt
aatggagcatcaaatgtcatttaa

DBGET integrated database retrieval system