KEGG   Pantoea ananatis AJ13355: PAJ_1655
Entry
PAJ_1655          CDS       T01969                                 

Gene name
pknA
Definition
(GenBank) serine/threonine-protein kinase PknA
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal CarboxypepD_reg
Other DBs
NCBI-ProteinID: BAK11735
UniProt: A0A0H3L1J1
Position
complement(2000770..2002233)
AA seq 487 aa
MSENDNHQNVPNALPIGYRFNEFEIKDVIGGGGFGIVYRAWDHQLERDIAIKEFMPASLA
VRSDDLNLVLRSERFSKTFHAGLNSFIQEARLLARFNHPNLLHVLRFWVQNDTAYMGTVF
YSGTTLSNMRERHPHLIDENWIRRLLPPLLGAIKTIHDAGYLHRDISLDNIQIQSNGDPV
LLDFGSARKTIGNLSDESETMLRPGYAPIEQYSDNDESEQGAWTDIYALGAVLHTLITGA
PPPVSVVRSIEDNYQPLVQRAPAGYSQTLLAAVDRALALKPEDRPQSIDAFAASMVLPEK
APEPLPEVKHSGPGTMLVPVQEEDEAAATPATPLKKLMRNRFALPGLVAAGVLVGVCVGV
LMAGGDKDGDAPANVAQTETAPATQAPTEQPAATPVQTQTAQAEPEKPQEPVAPPPEPVA
QVYIKLQPGERVQVNGKPQAVVPAANGFAALQLAPGNYTFSVTGQGGEREQTLTINQQGV
WLLDPHI
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgtcggaaaatgataatcaccagaatgtacccaatgccctcccgattggttaccggttt
aatgagtttgaaatcaaagatgtcatcggcggtggcggtttcggcattgtctatcgtgcc
tgggatcaccaactggagcgcgatatcgcgattaaagagtttatgcccgcgtcgctggcc
gtgcgcagcgacgacctgaacctggtattgcggagtgagcgattcagtaaaactttccat
gcgggcctgaacagctttattcaggaagcccgtctgttggcacgttttaatcatccgaac
ctgcttcacgttctgcgcttttgggtgcaaaacgatacggcctatatgggcacggtgttt
tacagcggcaccacgctgtctaacatgcgtgaacgccatccccatctgattgatgagaac
tggatccgtcgcctgctgccaccgctgctgggtgccatcaagaccattcatgatgcaggc
tatctgcaccgcgacatctcgctggataatattcaaatccagagcaatggcgatccggta
ttactggatttcggctccgcgcgcaaaaccatcggtaacctttctgatgaaagtgaaacc
atgctgcgtccgggctatgcgccgattgaacagtacagcgataacgatgaaagcgagcag
ggcgcgtggacggacatttacgcgctgggggccgtgctgcacacgttaatcaccggtgca
ccgccgccggtcagcgtggtgcgcagcatcgaagataactatcaacccttggttcagcgt
gcaccggccggctacagccagaccttactggcggccgttgatcgcgcgctggcgctgaag
ccggaagatcgcccgcagagcattgatgccttcgcggcctcaatggtgctgccagaaaaa
gcgcctgaaccgctgcctgaagtgaagcacagtgggccgggtaccatgctggtaccggtt
caggaagaggatgaggcggctgccactccggcaacaccgctgaaaaagctgatgcgtaac
cgctttgctctgccgggtctggtcgctgcaggtgtgctggtgggggtttgcgtcggtgtc
ctgatggcgggcggcgacaaagacggtgatgcacctgccaatgtcgcacagaccgaaacg
gccccagccactcaggcaccgactgaacaacctgctgcaacgcctgtgcaaacccagaca
gcccaggccgagccggaaaaacctcaggagccggttgcaccaccgcctgaacctgtggcg
caggtttatattaagctccagcccggcgagcgtgttcaggtgaatggcaagcctcaggca
gtggttccggcagccaatggttttgcggcgctgcagctggcacccggcaactacacgttt
tctgtaacaggtcagggtggcgaacgtgaacaaacgttaaccattaatcagcaaggcgtc
tggttacttgatccccatatttaa

DBGET integrated database retrieval system