KEGG   Pantoea ananatis AJ13355: PAJ_1656
Entry
PAJ_1656          CDS       T01969                                 

Gene name
clpV
Definition
(GenBank) chaperone ClpB
  KO
K11907  type VI secretion system protein VasG
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAJ_1656 (clpV)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paj02044]
    PAJ_1656 (clpV)
Secretion system [BR:paj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAJ_1656 (clpV)
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA ClpB_D2-small AAA_5 AAA_16 AAA_22 Sigma54_activat Clp_N AAA_7 AAA_25 NACHT AAA_18 AAA_14 TniB ATPase_2 Zeta_toxin IstB_IS21 TsaE Rad17 SRP54 T2SSE Hpr_kinase_C AAA_33 DUF815
Other DBs
NCBI-ProteinID: BAK11736
UniProt: A0A0H3KXE9
Position
complement(2002263..2004872)
AA seq 869 aa
MSEISRAVLFGKLDTLLFTSLESATAFCKLRGNPYVELVHWLHQLMQQQDGDLQQVIKHF
SLDENALTRDIVAALDRLPRGAGAVSDLAEHIDSAVERAWVYASLKYGATRIRGGHLLIG
MLKTFTLASVLKGISPQFSRVNADALLEQFDTLLANSKEVQQALVQPAGDAAAPPAAGDS
TLAQYAQDLTARARDGKIDPVAGRDEEIRQMVDILMRRRQNNPLLTGEAGVGKTAVVEGL
ALRIAAGDVPAPLRDVQLWLLDIGMLQAGAGMKGEFEARLQALINEVQSSPTPIVLFIDE
IHTLVGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDPALTRRFQTVQVQ
EPDEAKAILMLRSTVSALEKHHQVLLLDEAVSAAVKLSHRYIPARQLPDKAVALLDTACA
RVAVSQGAQPAALEDCLHRLAALEIEAEIAEREAKVGLGDETRQATIAAQRAALEAERDA
LDARWQQERELVEQLIALRARCVTEGDTSLREQLDETRQKLHAVQGEAPLLFAAVDASVV
AAVVSDWTGIPLGRMVKNEIDAVLNLADTLNQRVIGQRHGLDLIAKRVRTSRARLDNPNK
PVGVFMLCGPSGVGKTETALALAESLYGGEQNIITINMSEFQEAHTVSTLKGAPPGYVGY
GEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHELFFQVFDKGWMEDGEGRHIDFRNTIIIL
TSNVGTQLISALCADPELMPDPDALSTALRKPLLEVFPPALLGRLLVVPYYPLSDEMLAE
IVKLQLGRIVRRLEENHGIEAIIDDSVVSQIVQRCTEVESGGRMVDAILTNTLLPQMSQI
LLSAHARDERYRRVQVSCDQGEFVCQFAV
NT seq 2610 nt   +upstreamnt  +downstreamnt
atgtcagagatcagccgtgccgtgctattcggcaaactggatacgctgttatttacctcg
cttgagagtgcgaccgccttttgtaaactgcgtggcaacccctatgttgaactggtgcac
tggttgcatcagctcatgcagcagcaggatggcgatcttcagcaggtgattaagcatttt
tcactggatgaaaacgcgctgacgcgggatatcgtcgctgcactggaccgcctgccgcgc
ggtgcgggtgcggtgtccgatctcgcagaacacatcgacagcgccgttgagcgcgcctgg
gtttatgcatcactcaaatacggtgctacccgtattcgcggtggtcacctgctgataggt
atgctgaagacctttacgctcgccagcgtcctgaaaggcatttcaccccagttttcacgc
gtgaacgccgatgctttactggagcagttcgataccttgctggcgaacagtaaagaagtt
cagcaggcgctggttcagcccgcaggcgatgctgccgcccctccggcggcgggcgacagc
acgttagcgcagtatgcgcaggatctgaccgcgcgagcgcgcgacggaaaaatcgacccg
gttgcgggccgtgatgaagagatccgccagatggtggatatcctgatgcgccgtcgccag
aacaacccgttactcaccggtgaagctggcgtgggtaaaacggcggtggtagaagggctg
gcgctgcgcattgccgccggtgatgtaccggcaccgcttcgtgacgtgcaactgtggctg
ctggatattggcatgttgcaggcaggcgccggcatgaaaggcgaattcgaagcgcgttta
caggccctgattaacgaagtgcaatccagccctacgccgattgtgttattcattgatgaa
attcataccctggtcggtgcaggcggtcagcagggcacaggcgatgccgccaacctgtta
aagccggccctggcgcgcggacagttgcgcacgattggcgcaacgacctgggcggaatac
aagaaatacatcgaaaaagatcctgcattgacccgccgcttccagaccgttcaggtgcag
gagccggatgaagcaaaagcgatcctgatgctgcgcagcaccgtgagcgcgctggaaaaa
caccatcaggtgctgttactggatgaagccgtcagtgccgccgttaagctctctcaccgt
tacattcctgcccgccagctgccggataaagccgtagccttactggataccgcctgtgca
cgcgttgccgtcagccagggcgcacagcctgccgcgctggaagactgcctgcaccgtctg
gccgcgctggaaatcgaagcggagatcgccgaacgtgaagccaaagtggggctgggtgat
gaaacccgccaggccactattgccgcccagcgcgctgccctggaagcagagcgcgatgcg
ctggacgcccgctggcagcaggagcgtgagctggtcgaacagctgattgccctgcgcgcg
cgttgcgtaaccgaaggcgacacttccctgcgcgagcagctcgatgaaacccgacagaag
ttgcatgcggttcagggtgaagccccgttactgtttgctgccgttgatgccagcgtcgtt
gccgcagtggtatccgactggaccggcattccgctgggccggatggtgaaaaacgaaatt
gacgccgtgcttaacctcgcggacacgctgaatcagcgcgtaattgggcagcgtcacggg
ctggatctgattgccaaacgcgttcgcacctcacgcgcccgactggacaatcccaataaa
ccggtcggtgtgtttatgctctgtggcccgtcaggcgtcgggaaaaccgaaaccgcgctg
gcgctggccgaatcgctttatggtggagagcaaaacatcatcaccatcaacatgagcgag
ttccaggaagcgcacaccgtttcaacgctgaaaggtgcgcctccaggctatgtaggttac
ggtgaaggcggtgtgctgacggaggccgtgcgtcgtcgtccttacagcgtcgtgctgctg
gatgagattgagaaagcgcatcctgatgtgcatgagctgtttttccaggtgttcgacaaa
ggctggatggaagatggagaagggcgccacattgatttccgcaataccattatcatcctc
acctctaacgtcggtacgcaactgatcagtgcgctctgtgccgatccggaactcatgccg
gatcctgacgcgctcagcaccgctttacgtaaacccttactggaggtgttcccgcctgca
ctgctgggccgtctgctggtggtgccttactatcccctcagtgacgagatgctggcagag
attgttaagctgcaactggggcgcattgttcgccgcctggaagagaaccacggtattgaa
gccattattgacgattcggtcgtcagccagatcgtgcagcgttgtacggaagtggagtct
ggaggtcgcatggtcgatgccatcctgacaaataccctgttgccgcagatgagccagata
ctgctcagcgcccatgctcgtgatgaacgttatcgtcgcgtgcaggtcagctgtgatcag
ggcgagtttgtttgccagtttgctgtctaa

DBGET integrated database retrieval system