KEGG   Pantoea ananatis AJ13355: PAJ_1657
Entry
PAJ_1657          CDS       T01969                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paj02044]
    PAJ_1657
Secretion system [BR:paj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAJ_1657
SSDB
Motif
Pfam: T6SS_TssG OGG_N
Other DBs
NCBI-ProteinID: BAK11737
UniProt: A0A0H3L4H9
Position
complement(2004926..2005975)
AA seq 349 aa
MSETAHVIPLQRAVRLPDGFWQAVMAAPWRYDLFQLLRKLDAQSGQRYALGKAPLPKFEA
VRLGQKPSLAFAPSTVSQVKAREQDERYDVSIYSFGLFGPNGPLPTHLTEYVRGRIDHHQ
DHSLSAFADLFHHRATLLFYRAWANSQPTSSLDRRDDRRFQDYLACVAGIGLPAQQKASS
LSLHARLMLSGHLSRHGHDAEGLVRILRHYFAVPVKLQQNVPQWLSLDSRDQARLSAGRH
MPRLGESAFLGVAVRDVQHRFRLRIGPLSAEQYERFLPNAQGACEVRDWVRHYLGIEMQW
DLSLILAADAVKGVTLGGQARLGYTSWLGQQPQPVDREDFAFEVEATPS
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgagtgagacggcgcacgttattcccctacagcgggcggtgcgtctgcctgacggtttc
tggcaggccgtgatggccgcgccctggcgctatgatctgtttcagctgttacgcaagctg
gacgcccagagtgggcagcgttatgccttaggtaaagcgccactgcccaaatttgaggcc
gtgcgtcttgggcaaaagccatccctggcctttgcaccgtcgaccgtgtcacaggttaaa
gcgcgtgagcaggacgaacgctacgacgtctccatttacagctttgggctgtttggtccc
aacggtcctctccctacgcacctgacggaatatgtacgcggacgtatcgatcaccatcag
gatcacagcctgagcgctttcgccgatctgtttcatcatcgtgccacgctgctgttctac
cgtgcctgggctaattcacagccaaccagctccctggatcgccgcgacgatcggcggttt
caggattatctggcctgcgtggccggtattgggttaccggcccagcagaaagccagttcg
ctgagtctgcatgcgcgcctcatgctgtcagggcatctcagccgccacggtcacgatgcc
gaagggctggtacgcattttgcgtcactactttgccgttccggttaagctgcaacagaac
gtgccgcagtggttgtccctggacagccgcgatcaggcccgtctgtcggccggtcgccat
atgccgcgcctgggtgaatcggcctttctcggtgtggccgttcgtgatgtacagcatcgt
tttcgtctgcgtatcggtccactgagcgccgagcagtacgaacgttttttacccaacgcg
cagggcgcttgcgaagtgcgtgactgggtgcgccactatctgggtattgagatgcagtgg
gatctcagcctgattctggcagccgatgccgttaagggcgtaacccttggcggtcaggcg
cggctgggctacaccagttggcttggacagcaacctcagcctgtcgatcgtgaagatttt
gcctttgaggttgaagctacgccgtcatag

DBGET integrated database retrieval system