KEGG   Pantoea ananatis AJ13355: PAJ_1658
Entry
PAJ_1658          CDS       T01969                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paj02044]
    PAJ_1658
Secretion system [BR:paj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAJ_1658
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: BAK11738
UniProt: A0A0H3KXD0
Position
complement(2005972..2007849)
AA seq 625 aa
MDSKLLDYYNRELAYLREMGAEFAAQYPKVAGRLGMRGIDVADPYVERLMEGFAFLTSRV
QLKMDAEFPRFSQRMLEMVAPGYLSPTPSMAIAQLTPDSRKGDISNGFLVPRGTMMESQN
LKKTGVTCSYTTAHDVMLQPLRISDVSLGGVPADIPLGELKAGGSTAASSALRIRITCEG
ISSLSQLSLDDVMFFLSGPDIQALKLMELLMQHRVGIILQSVEAKPQRQVLPDDALQQEG
FSTEQALLPDDLRNFDGYRLLQEYFAFPARFQFISLRQLAPFLQRCDNALSFDIVILLDK
ADAALESVVDSAHLALHCTPVINLFPKTAERLKVSDSQHEYHLVVDNIRPLDYEIHSVKR
LFASVEGQREEQIFRPFWSTFSHDGGDYGAYFSLRREQRTLSEHALRYGTRTGYIGSEVF
LSLVDQNHTPWNSDIRYLSAEVMCTSRDLPLMLLQQEQANFVMPDSIPVGQLKLCKGPTP
PRPALAEGLSAWRLISHLQMNYLSLMDSSDGEGAAALRQMLSLYASLAETPLTRQIDGIR
HCNLKAVHRRVPEPGPVVFARGVSIALEVDEQAFSGASPWLFGSVLERVFSRLVALNSFT
EFTLSSQQRGEVGYWPPRMGKKALL
NT seq 1878 nt   +upstreamnt  +downstreamnt
atggacagcaagctgcttgattactacaaccgtgaactggcctatctgcgcgagatgggc
gcggagtttgctgcccagtatcccaaggtcgccgggcggcttggtatgcgcggcattgac
gtcgccgatccttacgtcgaaagacttatggagggtttcgcgtttctgacgtcacgcgtg
cagttaaagatggatgccgagtttccacgcttttctcagcggatgctggaaatggtggca
ccgggctacctttcacctacgccgtcgatggccatcgcccagctcacgccggacagccgc
aaaggcgatatcagcaacggtttcttagtgccgcgcggcacaatgatggaaagccagaac
ctgaaaaaaacgggcgtcacctgcagctataccaccgcgcacgatgtgatgttacagccc
ctgcgtatcagcgatgtgtcgttaggtggcgtgccagcggatatcccgttaggcgagttg
aaagcgggcggctcgacggcggcgtccagcgccctccgtatccgcatcacctgcgaaggc
atttcatcgttaagccagctcagtctcgatgacgtgatgtttttcctgagcggacccgac
atccaggccctgaaactgatggagctgctgatgcagcatcgtgtcggaatcatcctgcag
tccgtggaagcaaaaccgcaacgtcaggttctgccggatgacgcgcttcaacaggaaggc
ttttcgaccgagcaggccctgctgcccgacgatctgcgtaattttgacggctaccgcctg
ctgcaggagtattttgcattcccggcacgcttccagtttatcagcctgcgtcagctggcg
cctttcctgcagcgctgcgataacgccctgtcgtttgacatcgtcatcctgctggataag
gccgatgcggcgctggaaagcgttgtcgacagcgcccatctggccctgcactgcacgccg
gtcattaacctgttcccgaaaaccgccgagcggcttaaggtcagtgacagtcagcacgag
tatcacctggtggtcgataacattcgtccgctggactatgagatccattcggtgaagcgc
ttgttcgcctctgtcgaagggcagcgcgaagagcagatcttccggccgttctggagcacc
ttcagccatgacggcggggattatggcgcgtatttctccctgcgtcgtgaacagcgcacg
ctctctgagcacgcgttgcgctatggcacccgaacgggctatatcggttctgaagtgttt
ctctccctggtggatcaaaatcatacaccgtggaacagcgatatccgctacttgtctgcg
gaagtgatgtgcaccagccgtgacctgcctttgatgctgctacagcaagagcaggccaac
tttgtgatgccggattccatccctgtcgggcaacttaaattgtgcaaaggcccgacgcca
ccgcgtccggcgctggctgaagggctttcagcatggcgactcatcagtcatctgcagatg
aactatctaagcctgatggacagcagcgatggcgaaggggctgcggcactgcgccagatg
ctgagcctgtacgccagcctggccgaaacgccgctaacgcgtcagattgacggaattcgg
cactgcaacctcaaagccgttcaccgtcgggtgcccgagccgggccccgtggtgtttgcg
cgcggggttagcattgcgcttgaggtggatgagcaggcgttttcaggtgccagcccctgg
ctgttcggcagcgtgctggagcgggtcttttctcgccttgtggcgcttaacagctttacc
gaattcaccctgagcagccagcagcgcggcgaagtgggctactggccgccgcgcatgggc
aaaaaggcgctgctatga

DBGET integrated database retrieval system