KEGG   Pantoea ananatis AJ13355: PAJ_1660Help
Entry
PAJ_1660          CDS       T01969                                 

Definition
(GenBank) hypothetical protein
  KO
K11898  type VI secretion system protein ImpE
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paj02044]
    PAJ_1660
Secretion system [BR:paj02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PAJ_1660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpE TPR_19
Motif
Other DBs
NCBI-ProteinID: BAK11740
UniProt: A0A0H3L1J5
Position
complement(2008417..2009244)
Genome map
AA seq 275 aa AA seqDB search
MDSLQQRLANATLAENLSSITAQIQANPADADLRAAFVQLLCLDGNWSRAQTQLKSWLAM
LPQAQPTVTLLQQAIEGEQKRAAVLRGEAEPQLPGSAWPWCQVLLAALKADIAGDKAVGA
ALRAQALESAEASAGTATTQEGESPFAWIMDGDSRFGPVCEAIANGHYYWIPFAAISEIE
FQAPASVTDLVWRHTRLQLVDGSEQICQIPVRYPLQDKADERFLRASVTEWQESGSDDGQ
FIGHGQKMWLSDEADYPLLTLQQLIFNETELPHES
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggactcattacaacagcgactggccaatgctaccctggcggaaaacctgtccagcatc
actgcacaaatccaggcgaatccggctgatgcggatttacgggcggcatttgtgcaactc
ctgtgccttgacggtaactggagcagggcgcagacacagctgaaatcctggctggccatg
ctgcctcaggcgcagcccaccgtgaccttgctgcaacaggctattgagggcgaacagaaa
cgtgcagcggttttgcgcggtgaagccgagccgcaactgccaggaagcgcctggccgtgg
tgccaggtcttactggccgcgctgaaagcggacatagcgggcgataaggccgtcggtgcg
gcactgcgtgctcaggcgctggaaagcgcagaggcgagcgccggtacggccacaacccag
gagggggaaagcccgttcgcctggataatggacggtgacagccgcttcggaccggtctgt
gaagccatcgccaatggacactattactggatcccgtttgctgccatcagcgaaatagag
tttcaggctccggcaagcgtcacggatctggtctggcgccatactcgcctgcagctggtg
gacggaagtgagcaaatttgtcagattccggtgcgctacccgcttcaggacaaggctgat
gaacgcttcctgcgggcaagcgtaacggagtggcaggaatcaggcagcgatgacggtcag
tttatcggtcacgggcaaaagatgtggctcagcgatgaagcagattatcccttactgacg
ctgcagcagcttattttcaacgaaactgagttacctcatgagtcgtaa

DBGET integrated database retrieval system