KEGG   Pantoea ananatis AJ13355: PAJ_1661
Entry
PAJ_1661          CDS       T01969                                 

Definition
(GenBank) putative type VI secretion system-associated protein hypothetical protein
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: DUF2470
Other DBs
NCBI-ProteinID: BAK11741
UniProt: A0A0H3KXF4
Position
complement(2009261..2010316)
AA seq 351 aa
MRRSFSLFEIENANMKYGLVGLTALLLSTHAFAENYRIVQSPTQKLDVWIDDVKDNQLSS
WCKSTVNLRIVTHGDKDASVLSDFLPRVAGLMASQCKPLQQLRWQLTDTEGGALANGTAA
KAQQWKSVVTPPAAAQPVQPAQPAQQAPVQQAPVSPPAAPVVLNSPAADTTPWLQFSLLD
GCHFRTWWHQPSQASALFVPAKQGVTCGKDGWLSGHSTLTQTGKDATKSVSVSFLQGFPV
AGLNDKQQVDELTITTVNSERMVLSDEKSPDSWLVLPFSQQFNGWQAINQVVVEMPASEA
ADENALRARLQEVRKIWSPWLSSPASIKVQLVEKLHPELKDPAAAVYRTIN
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgcggcgcagtttttccctcttcgagattgagaacgccaacatgaaatatggattagtg
ggcctgactgcattgctgttgagtacacatgcctttgcagagaactatcgcattgtgcag
tcgccaactcagaaactggatgtctggattgatgatgtaaaagataaccagctgtcgagc
tggtgtaagagcaccgtaaacctgcgcattgtgacgcatggcgataaagatgcgtcggtg
ctgagtgatttcctaccgcgcgttgcgggcttgatggcctcacaatgtaagccgttacag
cagctgcgctggcaattaaccgataccgagggcggcgcactggccaatggtacggccgcg
aaagcgcagcagtggaaatcggtggtgactccgcctgccgctgcacagcccgttcaaccg
gctcagcccgcccaacaggcgccggtgcagcaggcgcccgtcagcccgcccgccgcgcct
gtcgtgctgaattcgccagcggcggataccacaccgtggcttcagtttagcttgctggac
ggttgtcatttccgcacctggtggcatcagccctcgcaggccagcgccctgtttgtgccg
gctaaacagggcgtcacctgtggcaaagatggttggttaagcgggcacagcacgctgacc
cagacgggcaaagacgcgaccaaatccgtttccgtgagttttctgcaggggttcccggtt
gcgggcctgaacgataaacagcaggttgatgaactgaccattaccacggttaacagcgaa
cgcatggtgctgagtgatgaaaagtcacccgacagctggctggtgttgccatttagccag
cagtttaacggctggcaggcgataaaccaggtggtggttgagatgcccgccagtgaagcg
gcagacgaaaatgcgctgcgtgcgcgcctgcaggaagtgcgtaagatctggtcaccctgg
ttaagcagccctgcatccattaaggtgcagttggtggaaaaactgcatccggaactcaaa
gatccggccgcagccgtgtatcgcaccatcaactaa

DBGET integrated database retrieval system