KEGG   Pantoea ananatis AJ13355: PAJ_1663
Entry
PAJ_1663          CDS       T01969                                 

Definition
(GenBank) FHA domain containing protein hypothetical protein
  KO
K07169  FHA domain-containing protein
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    PAJ_1663
SSDB
Motif
Pfam: FHA UreE_N
Other DBs
NCBI-ProteinID: BAK11743
UniProt: A0A0H3KXD5
Position
complement(2011073..2012968)
AA seq 631 aa
MRFTIITAKPGHEPPQISFDFLPPGGTIGRGVDNNLILPDDDRTISRLQAIVHITAEGEC
RLTNRGNVTRVLLNDIPLERGRQVELQDGDILGIDDYRLLVNDLNGEQQSQQPPLTAAAA
PKPQPVPNAVPVQAPAASTAAIPSEIWDSLAKEFSISDDLSKRKSAAPEMPEANPLTSTA
ANRNPEDPLAQLMSDKPLDIGQQPKTSSLFDEEDALFAQESIFDDRTPSTLSAKQNAQGQ
PKIEETSTDVDPLNLFGSQTTPDPRHHDDPLGLMMSGAVPLAQPDMPVSQPVAAPSQPKE
NHQSAPLQQKELHQAAPLQPQENHQPMPDILDTAPVELADLSSSPLFDHTETQVTHDPAF
DPQPQPAQPEGAQSPIDYGGITLPTPQAVQRTPSPTPKGRLRIDPVASHNNSGGTEQSGN
ASSGDALKGELLDALLEGMGLQDLQPTPQFDREQMRQFGQMLSMFSQGTVALLSSRSILK
RGVKADMTVILDDANNPFKLLPSGKTVLMQMFGSRMPGFMPPRQAVRDALIDLQAHQLGM
IAGIRAIIASMLQSFNPDQLEEEARQNGSVSRIGLPGSRKAALWEHFIQRYGETAGEIED
DFHTLFGEAFLHAYDMEVNQYKDSQTHTDDA
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgcgctttacgataataaccgctaaacccggccatgaaccgccgcaaatcagtttcgat
tttcttcctccaggcggcactattggtcgaggcgtggataataatctgatattgcccgac
gacgatcgcactatttctcgcctgcaggctatcgtgcatattactgcagagggtgaatgt
cgcctgaccaaccgcggtaacgttacgcgcgtgctgctgaatgacatcccgcttgaacgt
ggacgtcaggtggagttgcaggacggagatattctcggcatcgacgactatcgcctgctg
gttaacgatcttaatggcgagcagcaatcgcagcagcctccgttgaccgctgcagccgca
cctaagccgcagcccgtacccaatgcggtccctgtacaggcgccggctgccagcacggct
gccattcccagcgagatctgggacagccttgccaaagagttttcaatttctgatgattta
tcgaaacgtaaaagtgctgcgccagaaatgccggaggcaaatccgttaacctctacagcg
gcaaaccgtaatcccgaagatccgctggctcagttaatgagcgataaaccgctagatatc
ggtcaacaacctaagacaagcagcctgtttgatgaagaggatgcactgtttgctcaggaa
agcatttttgatgaccgcacgcccagcaccttgtcggcaaaacaaaatgcgcaagggcag
cccaaaatagaggaaacctccacagacgtggacccgttaaatctgtttggcagccagacc
acgccggacccgcgtcatcatgacgatccgctggggttaatgatgagcggtgccgtgccg
ctggctcagccagatatgccggtttcgcaacctgtggctgcgccatcgcagccgaaagaa
aaccatcagtctgcacccttgcagcagaaagaactccatcaagcggcgccattacagccg
caagaaaatcaccagccgatgccagatatcctggatactgcaccggttgagttggctgat
ttaagcagttcaccgctgtttgatcacactgaaacgcaggtcactcacgatcccgctttc
gatcctcaaccgcagcctgcccagcctgaaggagcgcaaagcccgattgattacggcggc
attaccttgccaacaccgcaggcggtgcaacgcacgccttcgcccacgccaaaagggcgg
ctgcgcatcgatccggttgcctcgcacaataacagcggcgggaccgagcagagtggcaac
gccagtagcggcgatgccttaaagggcgagttgctggatgcactgctggaaggtatgggc
ctgcaggatctgcaaccgacaccgcagttcgatcgcgagcagatgcggcagttcggccag
atgctcagcatgttctcgcagggaacggtggcactgctgtcttcccgatcgattttaaaa
cgcggtgtaaaagccgacatgaccgtgatcctggatgatgctaacaacccgtttaagctg
ctgccgtcgggtaaaaccgtattgatgcagatgtttggcagccgtatgccaggttttatg
ccgccacgccaggccgtgcgtgacgctctgattgacctccaggcgcaccagttagggatg
attgccgggattcgcgccattattgcttccatgctgcagtcctttaaccccgatcagctc
gaagaagaagcgcgtcaaaacggttccgtatcgcgcattggactacccggcagccgtaaa
gccgcgctgtgggagcattttatccagcgctatggcgaaactgccggtgaaattgaagat
gacttccataccttgtttggcgaagccttcttgcacgcgtacgacatggaagtaaatcag
tataaagactcacaaacccacacggatgacgcatga

DBGET integrated database retrieval system