KEGG   Pantoea ananatis AJ13355: PAJ_1664
Entry
PAJ_1664          CDS       T01969                                 

Definition
(GenBank) EF Hand domain protein hypothetical protein
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: PG_binding_1 Pesticin PG_binding_3 ParB PhageP22-tail
Other DBs
NCBI-ProteinID: BAK11744
UniProt: A0A0H3KX29
Position
complement(2013999..2014874)
AA seq 291 aa
MSITGSVGIGGRNNYGDVKTVQRLLQNNGFPQLRDDGRIGPKTIEAIKSYQSRFMSRPDG
LVDVHGKTWSTLSRSGNDTNKILPPRNVDDPNVNSGRLTVNAGQVTFDAEGNDNIHSPYF
SRHIHWPGYNSGVTIGRGYDMGGRSTGEIYSDLLMVGVEQEQARRLSLGSTKKGSEAHAW
VKKHREECGIISRESQARLFESIYPIYVNRAKSSYLSKTASHQERTDWDKLKPVIKDIIV
DLVYQGAGSTINMQAAMHNDVDKLADFIDSSAYLQKFEKGRNRARYLRSRR
NT seq 876 nt   +upstreamnt  +downstreamnt
atgagtattacagggtcagttggtataggtggccgcaataattacggcgatgtaaaaacg
gtacaacgacttttacaaaataatggttttccccagcttcgtgatgatggacggataggg
ccaaaaactattgaagcaataaaaagttaccaatcacgtttcatgtcacggccagatggt
ctggttgatgtacatggaaagacatggagtacactctctcgctcaggtaacgatactaat
aaaattttaccacctagaaatgtcgatgatccaaatgttaattctggccgtcttaccgtt
aatgcgggacaagttacatttgatgctgaaggtaatgacaacattcatagtccttatttc
agtaggcatatacattggcctggatataactcaggtgtaactatcggaagaggttacgac
atgggaggaagaagtacaggtgaaatttactctgatcttttgatggtgggggttgaacaa
gagcaggcaagacgcctttctttaggctccacaaaaaaaggaagtgaggctcatgcctgg
gttaaaaaacacagggaggaatgcggcatcatatcacgtgagtcgcaggcaaggctcttt
gagagtatttacccaatatatgtaaatcgtgctaaatcttcctatctttctaaaacagct
agtcatcaagaaagaacggattgggataagctgaagcctgtaatcaaagatattattgtg
gatttagtttatcaaggtgcaggttcgacaataaatatgcaggccgctatgcataatgat
gtcgataaattggcagattttattgatagctcagcttatctacaaaagtttgaaaagggt
cgtaatcgtgctcgttatctgagaagtagacgataa

DBGET integrated database retrieval system