KEGG   Pantoea ananatis AJ13355: PAJ_1666
Entry
PAJ_1666          CDS       T01969                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paj02044]
    PAJ_1666
Secretion system [BR:paj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAJ_1666
SSDB
Motif
Pfam: VipB VipB_2 HSCB_C
Other DBs
NCBI-ProteinID: BAK11746
UniProt: A0A0H3KXF9
Position
complement(2016061..2017560)
AA seq 499 aa
MNQTSQQPQSQGGASFSQDEFSALLNKEFRPKSDQAREAVESAVKTLAQQALENTVTMSS
DAYRTIQALIAEIDEKLSQQVNQIIHHDDFQKLESAWRGLSYLVNNTETDEMLKIRFMSI
SKQELSRTLKRYKGVGWDQSPLFKKIYEQEYGQFGGEPFGCLVGDYYFDHSPQDVELLGE
MARIGAAAHCPFITGTAPSVMQMESWQELANPRDLTKIFQNTEYAAWRSLRESEDARYLG
LVMPRFLSRLPYGIRTNPVDSFDFEEQTDGSDHSNYSWTNAAYAMATNINRSFKEYGWCT
SIRGVESGGAVEDLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFMPLVHRKNSDF
AAFIGAQSLQKPAEYHDADATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVNVEEQEDNPGYYAAKFFLRPHYQLEG
LTVSLRLVSKLPSLKSNEN
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgaaccagacttctcaacaaccacaatcgcagggcggtgccagctttagtcaggatgag
ttcagcgcgttactgaacaaagaattccgtcctaaaagcgaccaggcacgcgaagctgta
gaaagcgcggtaaaaaccctggcgcagcaggcgctggaaaacaccgtgaccatgtccagc
gatgcctaccgcaccattcaggcgctgatcgctgagattgacgaaaagctgtctcagcag
gttaaccagatcatccaccatgatgactttcagaagctggaaagcgcctggcgtggtctg
agctatctggtgaataacaccgaaactgatgagatgctcaagattcgctttatgagcatc
tccaagcaggaactgagccgcactctgaaacgctataaaggcgtgggctgggatcagagc
ccgctgttcaagaaaatctacgagcaggaatatggccagtttggtggtgaaccttttggc
tgcctggtgggcgactactatttcgatcacagcccgcaggacgttgagctgctgggcgag
atggcgcgtatcggtgctgcagcacactgtccgtttatcaccggtactgcaccaagcgtg
atgcagatggaatcctggcaggaactggcaaacccacgcgatctgaccaaaatcttccag
aataccgaatatgctgcctggcgtagcctgcgcgagtctgaagacgcgcgctatctgggc
ctggtgatgccgcgcttcctgtctcgtctgccttacggtattcgcaccaaccccgtggac
agctttgattttgaagagcagaccgacggttccgaccacagcaactacagctggaccaac
gcggcttatgccatggcgactaacatcaaccgttccttcaaggagtacggctggtgtaca
tctattcgcggcgtggagtcgggtggggccgttgaagatctgccttgccacacgttccca
agcgatgacggcggcgtagacatgaaatgcccaacggaaatcgccatcagcgatcgccgc
gaagccgagctcgcgaagaatggctttatgccgttagttcaccgcaaaaactctgacttt
gccgcctttatcggcgcccagtcgctgcaaaagcctgcggagtaccacgatgctgacgcc
accgccaatgcgcgtctggcagcgcggctgccttatctgttcgcctgctgccgtttcgct
cactatctgaagtgtattgtgcgcgacaagattggttccttccgcgagcgcgacgaaatg
gaacgctggttgaacgactgggtgatgaactatgtcgatggtgacccggctaactcttct
caggaaaccaagtctcgtaagccgctggctgctgcagaagtgaatgtggaagagcaggag
gacaacccaggctactatgctgcaaaattcttcctgcgtccgcattaccagttggaaggg
ttaaccgtttcgctgcgtctggtatcgaaactgccttcgctgaagtcgaacgaaaactaa

DBGET integrated database retrieval system