KEGG   Pantoea ananatis AJ13355: PAJ_1668
Entry
PAJ_1668          CDS       T01969                                 

Definition
(GenBank) ImpA-related N-Terminal family hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paj02044]
    PAJ_1668
Secretion system [BR:paj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAJ_1668
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: BAK11748
UniProt: A0A0H3KXD9
Position
complement(2018171..2019193)
AA seq 340 aa
MSIDIDTLLIPVSHDNPCGENLEYDADFQAMEQASVGKAEQQFGNTIIPAEPADWNKVEK
LALELMSRSKDLRVMLTLTHAWTRLKGLPGYAQGLQLIEQAMLQFWEPLWPRLEEDGEHD
PFYRINALAVLGDQSALTAAVRQSWLMRYASDGITLRDASALCDGSKTEVPDYPGGLPRL
NDELARGEQPGIAAIQNIAERLQNIRRIVIEKLDETALPDMSQLQRSMAMLNERCQATDM
ESLHSLAAAMQSAPATEQQPSVAAPRAATDWRSAQLNSRAEAQLMLEKVKQYFSQHEPSH
PAPLMIDRVQRLIELDFMDIIRDLAPDGVHQLENIFGRRD
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagtattgatattgacacgttgctgataccggtaagccatgataatccgtgcggtgaa
aacctggagtacgacgcggactttcaggcgatggagcaggccagcgtgggaaaagccgaa
cagcagttcggtaacaccattattccggctgagccagcggactggaacaaagttgaaaag
cttgcactggaactgatgagccgcagcaaagacctgcgtgtcatgctgaccctgacacat
gcctggacgcgcctgaaagggttaccgggctatgcacagggcctgcaactgattgaacag
gcgatgttgcagttctgggaaccgctctggcctcgccttgaagaagatggcgagcacgat
ccgttttaccgcatcaacgcgctggctgtgctgggcgatcagtcggcacttacggccgcc
gttcgtcagtcatggctcatgcgctatgcgtccgatggtattacgctgcgtgatgcttcg
gcgctgtgtgacggcagtaaaacagaggtgccagattatccgggtgggctgccgcgtctg
aatgacgaacttgcacgaggggaacaaccgggcatcgcagcgattcaaaacattgctgag
cgtttgcaaaatattcgccgcatcgtgattgaaaagctggatgaaacggccttgccggat
atgagtcagctgcaacgcagcatggcaatgctgaatgagcgctgtcaggccacggatatg
gaatcgttacactccctggcggcggcgatgcaatccgcacccgcaacggagcagcagccc
agcgtcgctgcaccacgtgcggctaccgactggcgcagtgcccaactgaattcgcgggca
gaagcccaacttatgctggaaaaggtcaaacagtactttagtcagcatgagccgagccac
ccggcaccgctgatgattgacagggtacagcgccttatcgaactcgattttatggacatc
attcgcgatctcgcgcccgatggtgtgcatcagttagaaaacatttttggacgccgcgac
taa

DBGET integrated database retrieval system