KEGG   Pantoea ananatis AJ13355: PAJ_1670
Entry
PAJ_1670          CDS       T01969                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAJ_1670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paj02044]
    PAJ_1670
Secretion system [BR:paj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAJ_1670
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C Xpo1
Other DBs
NCBI-ProteinID: BAK11750
UniProt: A0A0H3L1K6
Position
complement(2019932..2023222)
AA seq 1096 aa
MLKKAHFQRQSSKGAPFWAQRFSHQYLYQLPWYMIIGAPGAGKTTALVNSGLQFPLADKF
GKAALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESQQERDAGEWHQFLDLLRKYRGRQP
VNGVIVTLSVADLLSQSPEAMRNQAVALRQRLMELHDRLGIRFPVYVLVTKTDLLKGFRS
YFASLDKAQREQIWGFTFPWAKASTAEFELSSQFQQEYSLLQQRLDAGLADVLLAESDAQ
ARAESYLFPQEFAALRPQLAEALDILFARSDFETQFAPRGIYFASGTQEGLPFDRVMGEL
TRALHLPGQQQSESGSWDKVDKDAPIPQNKGQSFFLKGVLENVIFQESGLAGSNRWWELR
NRVGLWSGYLALLVIVLIAGALWLVSYNKNKTYLQEMAAKSPQVEQLGDKLQKEVNGNLF
ALVPYLNTLLHLPESASFSLEHPPLTRRMGLYRGTEVSDATQALYERALKQLLMPQVAQN
ITRWLRNDTGSDADYSYEALKAYQMLYQPKHYDGKFLQAWMMLNISRELPQDVTQAEVKQ
LAWHLQQLLETQIQSSPYAKDDALVKREQALISQMPLSQRVYGRLKRLLERDGSMSPVTL
SALGGPQSELVFSRKSGKSVNEGVSGLFTPDGYWNHVDKQIAPVTDALYKDDIWVLGAET
AHEDSKQTDLAVRQLYIQDYIRQWEQFLSDIQLNSSADLTQRINTARLLSGNHSPLRQLV
INLSKQLTLTRAQPEDKNAKDTAASSDNSATRTLQALFTSPRANGEQAVVQQTPEQAVTA
HFAPVIELAQPLQQGSKVLAVDDFLKQIDDLYRYLTAVQDAANSGMPPPASDAISRLQAS
AGRLPGSLQNMVSGMAVGASSDAQRRDMDNVRKRITMEVGSFCRQAIAGRYPLVRNARSE
VTPDDLARMFAPGTGLMDSFFRDNLASKVDTTRAAWRFTPGIDGKTLPGGEALLRPFQQA
QSIRDAFFANGATTPSFRVTLRTVKMDNDILNMTLDVDGQILRYSHGPQAVQLVSWPGPG
GTSQVRMQLGLTNGTTSTLTTSGPWALNRFFDRARVTSVGGLTREASFSVDGHNVTLSFT
PGSIRNPFQLPAFSCP
NT seq 3291 nt   +upstreamnt  +downstreamnt
atgctgaaaaaagcacacttccagcggcagagcagcaaaggtgcgcctttctgggcgcag
cgcttcagtcatcaatatctctatcaactgccctggtacatgatcatcggcgcgccaggt
gccggtaaaaccaccgctctggtgaattctggcttgcagttcccactggcggacaagttc
ggtaaggctgcgctacgtgggatcggcgggacgcgtaactgtgactggtggtttactaac
gaagccgtgctgctggatacggcggggcgctataccacgcaggagagccagcaggagcgc
gatgccggcgaatggcatcagtttctcgaccttctgcgtaaataccgtggccgtcagccg
gttaacggcgtcatcgtcaccttgagcgtggcagacctgttatcacagtcgcccgaggcc
atgcgcaatcaggccgtggcgctgcgccagcgtctgatggagctgcacgatcggcttggt
attcgctttccggtgtatgtcctggtcaccaaaaccgacctgttgaaggggttccgcagc
tactttgccagcctggataaggcacagcgcgagcagatttggggctttacctttccgtgg
gccaaagcatcaacggctgaatttgaactcagcagccagtttcagcaggaatattcgctg
ctgcaacagcgcctggatgccggactggccgatgtgctgctggcggaaagtgatgcccag
gcacgtgccgaaagctacctgtttccacaggagtttgcggcattgcgccctcagttggct
gaggcgctggatattctgtttgcgcgttccgatttcgaaacgcagttcgccccgcgcggc
atctactttgccagcggtacgcaggaaggcttaccctttgaccgcgtaatgggtgaactg
acgcgcgccctgcatctgccaggccagcagcagagtgagtcgggcagttgggacaaagtg
gataaagacgcgccgatccctcaaaacaaaggccagagttttttccttaagggcgtgctg
gaaaatgtcatcttccaggagtccggtctggctggcagtaaccgctggtgggagctacgt
aaccgcgtgggcctgtggtcgggttatctggcgttactggttatcgtactcattgccggt
gcactgtggctggtgagctataacaaaaacaaaacctacctgcaggagatggcggcgaaa
agcccccaggttgagcagctcggtgacaagttacaaaaagaggtgaacggcaacctcttt
gcactggtgccttacctcaatacgctgctgcacctgcctgaaagcgcatccttttctctg
gagcatccgccgctcacgcgccggatggggctgtatcgcggaacggaagtcagtgatgcg
acccaggccttgtacgaaagggcgctgaaacagctgctgatgccgcaggttgcccagaat
atcacccgctggttacgcaatgatacgggaagtgacgctgactacagctatgaggcgctc
aaggcttatcagatgctgtaccagccaaaacactatgacggtaagtttcttcaggcgtgg
atgatgttaaacatctcgcgtgaattgccgcaggacgtgactcaggctgaggtgaaacag
ctggcgtggcatctgcaacagctactggaaacgcagattcagtcctcgccctatgcgaag
gatgatgcgctggtaaagcgcgagcaggcgctgattagtcagatgccgctgtcacagcgc
gtttacggacgcctgaaacgcctgctggaacgcgatggctcaatgtcaccggttaccttg
tccgcgctgggtggaccgcaaagtgaactggttttttcccgtaaaagcggtaagtctgtc
aatgaaggtgtttccgggctctttacgccagacggctactggaaccatgtggataaacag
atcgcgccggtcacggatgcgctctacaaagacgatatctgggtgctgggtgcagagacg
gcccatgaagacagcaaacaaaccgaccttgcggtgcgccagctctatattcaggattac
atccgccagtgggagcagtttctcagcgatattcaactcaacagcagcgccgatttgacc
caacgtattaatacggcgcgcctgctgtcagggaatcattcgccgctgcggcagttagtg
attaacctgagcaaacagctcacgctcacccgggcgcagcctgaagacaagaatgccaaa
gatacggccgcgtcatcggataacagcgccacacgaacgctgcaggcactgtttacctcg
ccgcgcgcaaacggcgagcaggcggtggtgcagcaaacgcctgagcaggcggtgaccgcg
cactttgcacctgtcattgagctggcacagccgttacagcagggcagtaaggtcctggcc
gttgatgattttcttaagcagatcgacgatctctatcgctatctcactgccgtgcaggat
gccgcgaatagcggtatgccaccgccggcgagtgatgccattagccgtttgcaggccagc
gccggacgtttgcccggttcactgcaaaatatggtgtcaggcatggcagtgggcgccagc
agcgatgcacagcgtcgcgacatggataacgttcgcaagcgcatcaccatggaagtcggc
agcttctgccgtcaggcgatagcaggccgttacccgctggtccggaatgcacgcagcgaa
gtcacgcctgatgacctggcgcgcatgtttgcgccgggaaccggactgatggacagcttc
ttccgcgataatctggccagcaaagtggataccacgcgcgcggcatggcgcttcacgccc
ggcattgatggcaaaaccttgccaggtggcgaagccttgctgcgtcctttccagcaggcg
cagtcgattcgcgacgccttctttgccaatggggccactacgccatccttccgcgtcacg
ttacggacggtgaagatggataacgatatcctgaatatgacgctggatgtcgatggacag
attttgcgctacagtcatggaccacaggcagtgcagttagtgagttggcccggaccaggt
ggaaccagtcaggtgcgcatgcaactggggctaacgaacggcacgacctcaaccctgacc
accagcggcccatgggcgcttaatcgcttctttgatcgcgcacgggtgacgtcggtaggt
ggactgactcgcgaagccagctttagtgtggacggccataatgtgacgctgtcattcacg
ccaggcagcattcgtaatcctttccagctacccgcatttagctgtccctga

DBGET integrated database retrieval system