KEGG   Pantoea ananatis AJ13355: PAJ_1671
Entry
PAJ_1671          CDS       T01969                                 

Gene name
ytxE
Definition
(GenBank) flagellar motor protein YtxE
  KO
K11892  type VI secretion system protein ImpK
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAJ_1671 (ytxE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paj02044]
    PAJ_1671 (ytxE)
Secretion system [BR:paj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAJ_1671 (ytxE)
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: BAK11751
UniProt: A0A0H3KXG4
Position
complement(2023563..2024804)
AA seq 413 aa
MMQEQNKPNSDAFQQDLSHQNSLVAAANPLINAIPQIRHSVSHDDPARLRQQLIDQIRRF
ELACQQSGLSYEVIVGARYCLCTALDEAAALTPWGSRGVWTSNGLLVTFHNETWGGEKFF
QLLAKLSQNPRQHILLLELIYFCLLLGFEGRYRVLDNGRSQLDTIKQRLLQMIRSVRGSF
AAALSPHPTDQPVLRKLWRPMIPLWACAALAGLAACLFYIVLNWRLGDYTSPVLAKIYQT
TLPEVQIRNPAPPPPPSLNLKSFLKPEIDEGLVAVRDEADQSVVTLKGDGLFASGSTEVR
GRYDAVIQRVAEAMNNVSGKILVVGYSDNVPIRSARFASNYELSLARAQSVQTLLQKQLA
KPSRVKAEGRGETHPLVPNTSAENRARNRRVEITLQVAPDTTQAEVNGLARGN
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgatgcaggaacaaaataaaccgaacagtgatgcttttcagcaggatcttagccaccag
aatagtttggtggctgcagcgaatccgctgattaacgcgattccacagattcgtcactcc
gtctcccatgacgatcccgcacgtttacgtcaacagcttattgaccagatccgccgtttc
gagctggcctgccagcagtccggactgagctatgaggtgatcgttggcgcgcgctattgt
ctgtgtacggcgcttgatgaagccgcagcactgacgccctggggaagccgtggcgtgtgg
accagtaatggcttactggtaaccttccacaacgaaacctggggcggggagaaattcttc
caactgctggcgaaactgtcgcaaaacccgcgtcagcacatcctgttactggagctgatc
tatttctgcttactgcttggttttgaagggcgctatcgggttctggataatggacgctcg
caactggatacgattaaacagcgtctgttgcagatgatcaggagcgtcaggggcagcttt
gccgccgccttgtcgccgcatccgaccgatcagccggttctgcgtaaactctggcgcccc
atgattccgctgtgggcctgtgcggctctggcgggcctggctgcctgcctgttctatatc
gtgctgaactggcgtctgggggattacacctcgcccgtgctggccaaaatctaccaaacg
acgctgccagaagtgcagattcgtaatccggcaccgccgccgccgccgtcactgaacctg
aagtcattcctgaaacctgaaatcgacgaaggcctggtggccgtgcgcgatgaggcagat
caaagtgtggtgacgttgaaaggcgatggcttgttcgcatccggttcgacagaggttcgc
ggacgttatgatgccgttatccagcgtgtagctgaagccatgaataacgtcagcgggaaa
atcctggtggtgggctacagcgataacgtaccgattcgcagtgcccgatttgcctccaac
tatgagctgtctctggcccgtgcccagtctgttcagacgctgttacaaaaacagctggca
aaaccatcacgcgttaaagcggaagggcggggtgaaacgcatccgttggtgccgaatacc
agtgcagaaaatcgcgcgcgtaatcgtcgtgttgaaattacgctgcaggttgcacctgat
acgacgcaagctgaagttaacggcctggcgagagggaactaa

DBGET integrated database retrieval system