KEGG   Pantoea ananatis AJ13355: PAJ_1673
Entry
PAJ_1673          CDS       T01969                                 

Definition
(GenBank) predicted lipoprotein hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAJ_1673
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paj02044]
    PAJ_1673
Secretion system [BR:paj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAJ_1673
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: BAK11753
UniProt: A0A0H3KXE2
Position
complement(2026183..2026686)
AA seq 167 aa
MAQTYFRVGLAKWIWPFLLLLLTACSSSKPDIARYNLHFQAHPSINSGAPLKVRVMLLTS
DAEFMSADFFTLQNQPATALGNTLLNNQQFFLMSGQLSKTLSAKSLPDARFIGIMAEYQK
LDGKVWRLALPFPDSDSSSFWQFWKSNDGELNANIIVDDAGMRPVKQ
NT seq 504 nt   +upstreamnt  +downstreamnt
atggcacaaacttactttcgcgttggcctggcaaaatggatctggcccttcctgctgctt
ctgctaacggcatgcagtagcagtaagcctgatattgcgcgatacaacctgcactttcag
gctcatccttccatcaattcgggcgcacctctcaaagtccgggtgatgttgctgacgtct
gatgcagaatttatgtccgccgacttcttcactctgcagaatcaacccgctaccgcactg
ggaaatacgctgctcaacaatcagcagtttttcctgatgtccggtcagctcagtaaaacg
ctgagtgccaaaagcctccccgacgcgcgctttatcggcatcatggcggaatatcaaaag
ctggatggcaaggtgtggcgacttgcgctgcctttcccagacagtgacagcagctcgttc
tggcagttctggaaaagcaatgatggtgagttaaacgccaacattatcgttgacgatgcc
ggcatgcgtcccgttaagcaataa

DBGET integrated database retrieval system