KEGG   Pantoea ananatis AJ13355: PAJ_1674
Entry
PAJ_1674          CDS       T01969                                 

Definition
(GenBank) putative type VI secretion system-associated hypothetical protein hypothetical protein
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: AUX_IAA SH3_3
Other DBs
NCBI-ProteinID: BAK11754
UniProt: A0A0H3KX41
Position
complement(2026710..2027309)
AA seq 199 aa
MELNMKKMVNFRIALSLMFVFAVAGCKTPPKMTDDTMVSSTVDGTTLIHRHAVAAPAQFS
ALNESYRALYPASVMTRPDFGGKVVETLKTGETYTVVGQVENNWLALGEEAQAEAPPAAS
DAKATDSKAAPAQATTSAIKVVGYVPFRAVVKSDLYDQTVKADQPKRRARAAAKKKTCVS
VDGNSQACQNKNNGTWIIN
NT seq 600 nt   +upstreamnt  +downstreamnt
atggaactaaatatgaagaaaatggtgaactttcgaattgcattaagcctgatgtttgtc
tttgctgttgcaggctgtaaaacaccgccaaaaatgactgatgacacaatggtgagcagc
accgttgatggcacaaccctgatccatcgtcatgccgttgctgcgccggcgcagttctcc
gcattaaatgaatcctatcgcgccttatatcctgcatcggtgatgacgcgtccggacttc
ggcggcaaagtcgtcgaaaccctgaaaacaggtgaaacctacaccgttgtgggtcaggtt
gaaaataactggctggcattaggtgaagaagcgcaggctgaagcgccaccagcagccagc
gatgccaaagccactgacagcaaagcggcaccggctcaggccacaaccagcgcgataaaa
gttgttggttatgtgcctttccgcgctgtggtgaaaagcgatttgtacgatcagaccgtt
aaagccgatcagccgaaacgtcgtgcgcgtgccgccgccaagaaaaaaacctgtgtttct
gtagatggaaacagccaggcgtgccagaacaagaataacggtacctggatcattaactaa

DBGET integrated database retrieval system