KEGG   Pantoea ananatis AJ13355: PAJ_1675
Entry
PAJ_1675          CDS       T01969                                 

Gene name
yeeO
Definition
(GenBank) multidrug efflux protein NorA YeeO
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: MatE Polysacc_synt_C
Other DBs
NCBI-ProteinID: BAK11755
UniProt: A0A0H3L1L1
Position
complement(2028419..2029714)
AA seq 431 aa
MGVLSTFLVSWLGKEAMAGVGLADSFNMVIISFFAAIDLGTTVVVAFSLARRNGKRARAA
TRQSLAMMTILALILVIAIEFWGHLIIDAIAGAAEPKVKALALSYLQVSAWSYPAAAITL
IGSGALRGAGNTKIPMLINGGMNILNIMISSVLIYGCFSWDGLGFVGAGLGLTITRYIGA
FAIIYVLMIGFNASLKITLSNYFRRWNSSILYEVLSIGVPASIESVLFNGGKLLTQVFVA
GMGTNEIAGNFIAFSVASLINLPGNALGSASTIITGKRLGKYQVFQAERQAKHVFWLATI
CLSCVAALTVPLAGLLARFYTSDPEVINVTKHLIWLNALFMPIWAASWVLPAGLKGARDA
RYTMYVSMFSMWCARVVAGYLLGIELGMGVIGVWLGMFLDWTVRGLFFWGRFTSGKWLNN
YRKMIAKAGPS
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgggcgtgctcagtaccttcctggtcagctggctgggtaaagaggcgatggcaggcgtt
ggcctggctgacagttttaatatggtcatcatctccttttttgccgccatcgatctgggc
accacggtggtggtcgctttcagtctggcaaggcgtaatggtaaacgggcgcgtgccgct
acgcggcagtcgctggcgatgatgaccattttggcgctaattctggtcattgcgattgag
ttctggggccatctgattattgacgccattgccggcgctgccgaaccgaaagtaaaagcg
ctggcgctgagctatctccaggtttcggcatggagctatccggcagcggccatcacgcta
atcggcagtggcgcgctgcgtggggcagggaataccaagatcccgatgctgattaatggc
gggatgaatatcctcaatatcatgatcagcagcgtacttatttacggctgcttttcatgg
gatggactggggtttgtcggcgctggattagggttaaccatcacccgctacatcggcgct
ttcgccattatttatgtgttaatgattggatttaatgcttcgcttaaaatcacgctttcc
aactattttcgtcgctggaacagcagcatactttatgaagtactgagcattggcgtgcct
gccagtatcgaatctgtgctgtttaacggcggtaaattgctgacccaggtatttgtggct
ggcatgggcaccaatgagatcgcgggtaactttattgcgttttctgttgcctcgctgatt
aacctgccgggtaacgcgcttggatcggcttcaaccatcatcaccggaaagcggctgggt
aaataccaggtatttcaggctgaacgacaggcgaagcatgttttttggctggcaaccatt
tgcctgtcgtgcgttgcggccctgaccgttccgctggcgggcttgttggcacgtttctat
accagcgatcctgaagtgataaatgtcacgaaacacctcatctggctcaatgccttgttt
atgccgatttgggcagcgtcgtgggttttaccggctgggctgaaaggcgcgcgtgacgca
cgttacacgatgtacgtctctatgtttagtatgtggtgtgcaagggtcgtggctggctat
ttgctgggcattgaactgggaatgggcgtcatcggcgtctggcttggcatgttcctcgac
tggacagtgagagggctgtttttctggggaaggttcaccagcggtaaatggctgaataat
taccgtaaaatgatcgcgaaagccgggccatcctaa

DBGET integrated database retrieval system