KEGG   Pantoea ananatis AJ13355: PAJ_1676
Entry
PAJ_1676          CDS       T01969                                 

Gene name
amn
Definition
(GenBank) AMP nucleosidase Amn
  KO
K01241  AMP nucleosidase [EC:3.2.2.4]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00230  Purine metabolism
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PAJ_1676 (amn)
Enzymes [BR:paj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.4  AMP nucleosidase
     PAJ_1676 (amn)
SSDB
Motif
Pfam: AMNp_N PNP_UDP_1
Other DBs
NCBI-ProteinID: BAK11756
UniProt: A0A0H3KXG9
Position
2030229..2031683
AA seq 484 aa
MPAQRKNLTRQQALDTLEQMYDEAVNALRASIKAYTEEGSLPDPVARAQGLFVYPELRIT
WQGDGPQQNRTRAWGRFTHTGSYSTTVTRPALLRHYISEQLAMLEKEYEVTIDVGPSRQE
IPYPYVIDGSDLSLDRTMSAGIARHFPTTELSQIGDETADGLFHADATFPLSHFDALRTD
FSLARLRHYTGTAVEHFQPFVLFTNYTRYVDEFVRWAIEQVRDPSTPFDSLVCAGDVVLT
ASTEDNEAMLSDLAWKKHQMPAWHLTSPNRRGITLINIGVGPSNAKTICDHLAVIRPHAW
LMIGHCGGLRESQRIGDYVLAHAYLRDDHVLDSVLPPDIPIPSIAEVQRALYDATKSVSG
MPGEEVKERLRTGTVVTTDDRNWELRYSASALRFNLSRAVAVDMESATIAAQGYRFRVPY
GTLLCVSDKPLHGEIKLPGQANRFYDGAISEHLQIGIRAVELLRAEGDKLHSRKLRTFNE
PPFR
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgccagcccaacggaaaaatctgacacgccagcaggcacttgatacgcttgagcagatg
tatgatgaagccgtcaacgctctgcgcgcatcaattaaggcctatacggaagaaggctcg
ctacccgatcccgttgcccgcgcgcaaggtctgtttgtttaccctgaactacgcattacg
tggcagggcgacgggcctcagcagaatcgcacccgagcctggggccgctttacccatact
ggcagttacagcaccacggtgacgcgccctgctctgctgcgccattacatctctgaacag
ctggccatgctggaaaaagagtacgaggtgacgatcgacgtcggtccttcgcgtcaggaa
attccctatccttatgtcatagacgggtccgatctgtcgctggatcgcaccatgagtgcg
gggattgcgcgtcactttccaacgactgaactgtcgcagattggtgatgaaacggcagat
ggtttatttcatgccgatgcgacctttcctctgtctcactttgacgcattgcgcacagat
ttttcgcttgcccgcctgcgccactataccggcacggcggttgagcattttcagcctttt
gtcctgtttaccaactacacgcgctacgtagacgaattcgtacgctgggccattgaacag
gttcgcgatccttcaacccctttcgacagccttgtgtgcgcgggcgatgtcgttctgacg
gcgagtacagaagacaatgaagccatgctgtctgacctggcctggaaaaagcatcagatg
ccagcctggcacctgacctcacccaatcgccggggcattacgttgatcaatatcggcgtg
ggcccgtccaatgctaaaacaatctgcgatcatctggcggtcattcgtcctcacgcctgg
ctgatgatagggcactgtggcggcctgcgcgagagtcagcgcattggtgactacgtgctg
gctcatgcatacctgcgcgacgaccacgtgctggacagcgttctgccgcccgacattccg
attccaagcattgccgaagttcagcgggctttgtatgacgcaaccaagtccgtgagcggt
atgccaggcgaggaggtaaaagaacggctacgcaccggaaccgttgtgacaacagacgat
cgtaactgggagctgcgctattcagcctctgccctgcgttttaatctgagccgggccgtg
gctgtcgatatggaaagtgcaacgattgctgctcagggataccgtttcagggtgccttat
ggcacattgctgtgtgtttcggacaagccgctgcacggtgaaatcaaactgccgggccag
gcaaaccgcttttacgacggcgcgatttcagagcatttacagattggtattcgcgcggtt
gaattattgcgcgccgaaggtgataagttgcattcacgtaagttacgtacgtttaacgaa
ccgcctttccgttaa

DBGET integrated database retrieval system