KEGG   Pantoea ananatis AJ13355: PAJ_1678
Entry
PAJ_1678          CDS       T01969                                 

Gene name
yieG
Definition
(GenBank) inner membrane protein YieG
  KO
K06901  adenine/guanine/hypoxanthine permease
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_1678 (yieG)
Transporters [BR:paj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   PAJ_1678 (yieG)
SSDB
Motif
Pfam: Xan_ur_permease
Other DBs
NCBI-ProteinID: BAK11758
UniProt: A0A0H3KXE7
Position
complement(2032897..2034195)
AA seq 432 aa
MMLEKLFKLKAHNTTVRTEVIAGITTFLAMAYILFVNPSILGATGMDKGAVFVATCLAAA
IGSVLMGLIANYPIALAPGMGLNAFFTYTVVLHMGYSWQIALGAVFLSAVIFFALSIFKI
REWIIKSIPLPLRAGIAAGIGLFLAIIALEGAGIVVDNPATLVGIGDLTKPGPLLAMLGF
IIIVVLEARRVTGAVLIGILIITFISMGIGLTKFGGVFSAPPSIAPTFMQLDIAGAFNVG
LISVIFAFLFVDVFDNTGTLLGVTKRAGLADEQGNVPKMGRALVADSAAALFGSLLGTST
TTSYVESAAGVSAGGRTGLTAIVVAVLFLLALFFSPLASSVPVYATAPALLFVAVLMTSG
LAEIDWKDITTAAPVTVTALTMPLTYSIANGIAFGFITWTVVKLLSGRTKEINAALIVLS
VLFVIKLGWLSA
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgatgttagaaaaactatttaaattaaaagcgcacaacacaactgtacgcactgaagtc
atcgccggtatcaccaccttcctggcgatggcctacattctgtttgttaaccccagtatt
ttgggtgcaaccggcatggataaaggggctgtttttgtcgcgacctgtctggcagccgca
attggttcggtgttaatgggactgattgccaactacccgattgcgctggcaccgggcatg
gggctgaatgcttttttcacctataccgttgtcttgcacatgggctacagctggcagatt
gcgctgggcgcggtattcctgtccgcagtgatttttttcgccttatcgatatttaagatt
cgcgagtggattatcaagagcattccgctgccgctgcgcgccggtattgccgcagggatc
ggtctcttcctggcgattatcgcgttggaaggcgcgggtatcgttgtggataatccggct
accctggtggggattggcgatctgacgaagccgggccccttactggcgatgttagggttt
atcatcatcgtggtactggaagcgcgtcgcgtcacgggcgcggtcttaataggcattctg
atcatcacctttatctcgatgggaattggtctgacgaaatttggcggtgtattttctgca
ccgccttcaatcgcaccaacgttcatgcagttggatattgcgggtgcatttaacgtcggc
ttaattagcgtgattttcgcgttcttgttcgtggatgtgtttgataacaccggcacgcta
ttgggtgtaaccaaacgcgccgggctggctgacgagcagggcaatgtgcccaaaatggga
cgcgcgctggttgcggacagtgcggctgcgctgtttggttcgctgctgggcacctctacg
accaccagttatgtcgagtctgccgccggagtgagcgcaggcggccgtaccggcctgacg
gcgattgtggttgcggtgcttttcctgcttgcgctgttcttttctcctctggcgtcaagc
gtgccggtttatgccaccgcgccagcattgctgtttgttgcggttttgatgacgtccggg
ctggccgaaattgactggaaagacatcaccactgctgccccggtaaccgtgaccgcgctg
acgatgccgctgacctactccattgctaacggtattgcctttggctttattacctggacc
gtggtgaagttgctcagcggacgcaccaaagagattaatgcggcactgattgttctgtct
gtattatttgtgattaaactcggctggctgagcgcctga

DBGET integrated database retrieval system