KEGG   Pantoea ananatis AJ13355: PAJ_1679
Entry
PAJ_1679          CDS       T01969                                 

Gene name
ompR
Definition
(GenBank) transcriptional regulatory protein OmpR
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: Response_reg Trans_reg_C
Other DBs
NCBI-ProteinID: BAK11759
UniProt: A0A0H3KX46
Position
2034643..2035386
AA seq 247 aa
MKPAILVVDDDHAVCDLLQDALSEHALLVYRCHQGKDALTMVCEHPDISLVMLDMMLPDT
NGLLVLQQLQRLRPDILVIMLTGMGSEAEMVVGLEMGADDYIAKPFNPRVVVARARAALR
RSGRVVLPETDHEGWRFNGWLLDETRCQLLNPQRETVPLTQGEYTLLRAMVRHARKVLTR
DQLLELTHSETMDVFDRTIDVLIMRLRRKIEANPHQPGLIRTIRGLGYVFSADVVKPEGL
RLSTQTA
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaagccagcaattttggtggtggatgacgaccatgccgtctgcgatttgttgcaggac
gcactcagtgaacatgcgttgttggtttatcgctgccatcaagggaaagatgccctgacg
atggtgtgcgaacatccggatatttccctggttatgctcgatatgatgttgcccgacacc
aacggtttactggttttgcagcagctgcagcgactgcggcctgatattctcgtgattatg
ttgaccggtatgggttcggaagcggaaatggtggtaggcctggagatgggggcggatgat
tatatcgccaagccctttaatccacgcgttgtggttgcgcgggcgcgggcggctctccgg
cgcagcgggcgcgtggtgttgccggaaactgaccatgagggatggcgctttaatggctgg
ctgcttgatgaaacgcgctgccagttgcttaatccgcagcgagaaaccgtgccgttaacg
cagggtgaatataccttgctgcgtgcgatggtgcggcacgcgcgtaaggtcctgacgcgc
gaccagttgctggaactcacccacagcgaaacgatggacgtgtttgaccgcaccatcgat
gtgctgattatgcggttgcggcgcaaaatcgaagcaaatccccatcagcccggcctgatc
cgcacgattcgtgggctgggttatgttttctcggcggacgtggtcaaacctgaaggtttg
cggctctccacgcaaacggcctga

DBGET integrated database retrieval system