KEGG   Pantoea ananatis AJ13355: PAJ_1680
Entry
PAJ_1680          CDS       T01969                                 

Gene name
rbsK
Definition
(GenBank) sugar kinase RbsK
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: BAK11760
UniProt: A0A0H3L1L7
Position
complement(2035323..2036375)
AA seq 350 aa
MGARRGILAAGVMLVDYVHRISHWPEQGWLAEVQHSEKAAGGAPLNVLLTLSRMQCQLPL
VAIGLLGNDADGDYLLAIMQASQIDHRWVQRTCDKPTAMTQVMTAPDGQRTFFFSPGANA
LLDRTHFAAVDDAQRIFHLGYLLLLETLDGADSEFGTRSARLLAQMQQRGYFTSLDLASR
AGDYRPQVLPALRWLDYLVINELEAQALSGVVLRDDNGIQPPAAFSLAAQWLAGQGVRQR
VVIHAPEGAWGQEVGGEGIWQPAWQLAPNEIVGSVGAGDAFCAGVLYASHEGDDMLSTLQ
LAHTCARFNLRAANAIDGIRPLTDMRQWMAQAVCVESRKPSGLTTSAEKT
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgggcgcgcggcgcggcattctggccgctggcgtgatgctggtggattacgttcatcgt
attagccactggccggaacagggctggctggctgaggtacagcatagcgaaaaagcggca
ggcggcgcaccgctgaatgttttacttaccctttcgcgcatgcagtgtcagcttccgctg
gtggcgattggcctgctaggcaatgacgccgacggtgattacctgctggctatcatgcag
gcgtcgcagatcgatcatcgctgggttcaacgtacctgcgataaacccacagcgatgacg
caggtgatgaccgcaccggacgggcaacgaacgtttttcttttcccctggcgcaaatgcc
ctgctggacagaacgcatttcgccgctgtagacgatgcgcagcgcatctttcatctgggc
tatttactgttgcttgaaacgctggacggcgcggacagcgaattcggcacgcgcagcgcc
cgtttgctggcccagatgcagcagcgtggctattttacctcgctcgacctggcgtcccgg
gccggggattaccgaccacaggtattgcctgcgttgcgctggttagattacctggttatt
aacgaactggaagcccaggcgttgtctggcgtcgttttgcgggatgataacggtattcag
ccacccgcagccttttccctggctgcgcagtggctggccgggcagggggtgcgtcagcgc
gtggtgatacacgcgcccgaaggcgcatgggggcaggaagtcggcggcgagggcatctgg
cagcctgcgtggcagctggcacccaacgagattgtgggcagcgttggcgcaggtgatgca
ttttgtgcgggcgtactctatgccagccatgaaggggatgacatgctgtcaacgctgcaa
cttgcgcacacctgcgcccggtttaatttgcgcgcggccaatgcaatcgacggtattcgc
ccgttgaccgacatgcggcagtggatggctcaggccgtttgcgtggagagccgcaaacct
tcaggtttgaccacgtccgccgagaaaacataa

DBGET integrated database retrieval system