KEGG   Pantoea ananatis AJ13355: PAJ_1681
Entry
PAJ_1681          CDS       T01969                                 

Gene name
fbaA
Definition
(GenBank) probable fructose-bisphosphate aldolase 1 FbaA
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00010  Glycolysis / Gluconeogenesis
paj00030  Pentose phosphate pathway
paj00051  Fructose and mannose metabolism
paj00680  Methane metabolism
paj01100  Metabolic pathways
paj01110  Biosynthesis of secondary metabolites
paj01120  Microbial metabolism in diverse environments
paj01200  Carbon metabolism
paj01230  Biosynthesis of amino acids
Module
paj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
paj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAJ_1681 (fbaA)
   00030 Pentose phosphate pathway
    PAJ_1681 (fbaA)
   00051 Fructose and mannose metabolism
    PAJ_1681 (fbaA)
  09102 Energy metabolism
   00680 Methane metabolism
    PAJ_1681 (fbaA)
Enzymes [BR:paj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     PAJ_1681 (fbaA)
SSDB
Motif
Pfam: F_bP_aldolase FMN_dh
Other DBs
NCBI-ProteinID: BAK11761
UniProt: A0A0H3KXH5
Position
complement(2036376..2037236)
AA seq 286 aa
MALISLAQGLAHAQKQGYALGAFNVLDTHFLRALFAAAEQQRSPFIINIAEVHFKYVTLD
QLVEAIKFEAAKHAIPVVLNLDHGLHFEAVMQAIRLGFTSVMFDGSTLSYEENIRQTREV
VKAAHAVGVSVEAELGAVGGDEGGALFGEADSEKFTDPRLAAEFVRETGIDTLAVAIGNA
HGKYKGEPKLDFDRLAAIREQTGVPLVLHGGSGISDADFRRAISLGIHKINFYTGMSQAA
LDAVERSLASRNTRYDEFAELLMAVENAICETVMQQMKIFGSVGQA
NT seq 861 nt   +upstreamnt  +downstreamnt
atggctttgatctctctggcacaggggctggcccatgcgcagaagcaggggtacgcgctg
ggcgcctttaacgttctggacacgcattttctgcgcgcgctgtttgcggccgcagagcag
caacgctcgccttttatcatcaatattgcggaagtgcattttaaatacgtcacgctcgac
cagctggttgaggcgataaagtttgaagcggcgaaacacgcgattccggtggtgctcaac
ctggatcacggtttgcactttgaggcggtgatgcaggcgattcgtctgggattcacctcg
gtaatgttcgatggctcaacgctgagttatgaagagaatattcgccagacgcgtgaagtg
gtcaaagcggcacatgccgtcggcgtgtcggttgaggcagaactgggcgcggtgggcgga
gacgaaggtggcgcgttatttggcgaagccgacagcgaaaaatttaccgatccacggctg
gctgctgagtttgtgcgtgaaaccggcattgatacgctggcggtggctatcggtaacgcc
cacgggaaatacaaaggggagcctaaactcgactttgaccggctggcggctatccgcgag
caaaccggcgtaccgctggtgctgcacggtggctcaggcatcagcgacgcggatttccgg
cgggcgatctcactcggcatccataaaatcaacttctataccggcatgtcgcaggcggca
ctcgacgcggtggaacgcagtctggcctcacgcaacacccgctatgacgagtttgccgaa
ctgctgatggcggtggagaacgcaatttgtgaaaccgtgatgcagcagatgaagattttc
ggcagcgtagggcaggcgtaa

DBGET integrated database retrieval system