KEGG   Pantoea ananatis AJ13355: PAJ_1682
Entry
PAJ_1682          CDS       T01969                                 

Definition
(GenBank) hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAJ_1682
Enzymes [BR:paj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     PAJ_1682
SSDB
Motif
Pfam: Lyx_isomer Cupin_2
Other DBs
NCBI-ProteinID: BAK11762
UniProt: A0A0H3L4K2
Position
complement(2037236..2037928)
AA seq 230 aa
MQRSEVNVFLQNTRDFFARQDIHLPPWADYDLSQWRQQQGDIEEIIALRLGWDLTSFGAD
DFLQTGLTLFTLRNGSPGGKPWHKPYAEKVMHVREGQVTPMHYHPRKMEDIINRGGGNLI
VELYNREGNEKANSPVTVSLDGITQTHAAGSQLRLSPGESVTLIAGVWHSFWGENGFGDV
LVGEVSMPNDDDNDNVFLTPLARFNALDEDQEPHRLLCNDYSHWLNLRSE
NT seq 693 nt   +upstreamnt  +downstreamnt
atgcaacgctccgaagtgaatgtgtttttgcaaaacacgcgggacttttttgcacgccag
gatattcatctgccgccctgggctgattacgacctcagtcagtggcgtcagcagcagggc
gacattgaggaaattatcgcgttacggctgggctgggacctcaccagctttggcgccgat
gattttctgcaaaccggcctgacgctctttacgctgcgcaacggctcgccgggcggcaag
ccctggcacaaaccttatgctgaaaaagtcatgcacgtgcgtgaagggcaggtcacgccg
atgcattatcatccccgcaaaatggaagacatcatcaaccgcgggggcggcaatctgatc
gtcgaactgtataaccgtgaaggcaatgagaaggcgaactcgccggtgacggtatcgctg
gatggcatcacacaaacccatgcggccggttcgcaactcaggctgtctccgggcgaaagc
gtgacgttaatcgccggcgtctggcacagcttctggggcgaaaacggctttggcgatgtg
ctggttggcgaagtctcgatgcctaacgatgatgacaacgataacgtatttttgacgccg
ctggcgcgctttaacgcccttgatgaggatcaggaaccgcaccggctgctctgtaacgac
tattcccactggctcaatctgaggagtgaataa

DBGET integrated database retrieval system