KEGG   Pantoea ananatis AJ13355: PAJ_1684
Entry
PAJ_1684          CDS       T01969                                 

Gene name
rbsC
Definition
(GenBank) ribose transport system permease protein RbsC
  KO
K10440  ribose transport system permease protein
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PAJ_1684 (rbsC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_1684 (rbsC)
Transporters [BR:paj02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    PAJ_1684 (rbsC)
SSDB
Motif
Pfam: BPD_transp_2
Other DBs
NCBI-ProteinID: BAK11764
UniProt: A0A0H3KX50
Position
complement(2038987..2039967)
AA seq 326 aa
MTQTARVNPPTVKRALMGDIMQTVGILPILILIVAVFGFVTPNFFTEANLLNITRQASIN
IVLAAGMTFVILTGGIDLSVGSMLGTTAVVALLTSLDPMLASLTIPMALGAGLVMGLFNG
ILVAWAGLPPFIVTLGTYTALRGAAYLLANGTTVINSDINFEWIGNGYLGPVPWLIVIAF
AVIAICWFILRRTTLGVHIYAVGGNIQAARLTGIKVGLVLIFVYGMSGLLSGLGGLMSAS
RLYSANGNLGVGYELDAIAAVILGGTSFVGGIGTITGTLIGALIIATLNNGMTLMGVSYF
WQLVIKGAVIIIAVLIDKYRTRHHVG
NT seq 981 nt   +upstreamnt  +downstreamnt
atgacacaaacggcacgtgttaatccaccgacggtcaaacgcgctctgatgggcgacatc
atgcagaccgtgggcattttaccgattttgattttaatcgtggcggtatttggttttgtc
acgcctaacttctttaccgaagccaatttgctcaacattacgcgtcaggcctccatcaat
atcgtgctggccgctggcatgacctttgtcatcctgacgggcggtatcgatttgtccgtg
ggctcgatgctgggcaccacggcggtggtggcgctgctgacgtcgctggacccgatgctg
gcgtcgctaactattccgatggcgctgggcgccgggctggtgatgggattgtttaacggc
attctcgtggcctgggccggactgcctccgtttatcgtcacgctcggcacctataccgca
ctgcgcggggcggcctatctgctggccaacggcaccacggtgatcaattccgatattaac
tttgagtggataggcaatggctacctggggccggtgccctggctgatcgtcatcgcgttc
gccgttatcgcgatttgctggttcattctgcgtcgcaccacgctgggcgttcatatctat
gcggtgggcggcaatattcaggccgcgcgactgaccggcatcaaagtgggcctggtgctg
atatttgtgtacggcatgagcggattgctgtcggggttgggcgggctgatgagtgcttcg
cgcctctacagcgccaacggcaatctgggcgtgggttatgagctggatgccattgccgcg
gtgattctgggcggcaccagtttcgtcggtggcatcggcactatcaccggcacgctgatt
ggggcgttgattatcgctacgctgaataacggcatgacattaatgggcgtctcctacttc
tggcagttggttattaaaggtgcggtcatcatcatcgccgtcctgatcgataaatatcgt
actcgtcatcatgtgggctga

DBGET integrated database retrieval system