KEGG   Pantoea ananatis AJ13355: PAJ_1685
Entry
PAJ_1685          CDS       T01969                                 

Gene name
rbsA
Definition
(GenBank) ribose transport ATP-binding protein RbsA
  KO
K10441  ribose transport system ATP-binding protein [EC:7.5.2.7]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PAJ_1685 (rbsA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_1685 (rbsA)
Enzymes [BR:paj01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.7  ABC-type D-ribose transporter
     PAJ_1685 (rbsA)
Transporters [BR:paj02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    PAJ_1685 (rbsA)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_30 SMC_N RsgA_GTPase AAA_29 TsaE AAA_10 AAA_25 MMR_HSR1 AAA_27 AAA_22 AAA_23 AAA_15
Other DBs
NCBI-ProteinID: BAK11765
UniProt: A0A0H3L1M2
Position
complement(2039978..2041492)
AA seq 504 aa
MTAKPILEMREITRRFGNFYALKGVDLTVYPGEVHALMGENGAGKSTLMKILAGAYAASS
GEVLIDGKPWQLKGPKEALAAGITLIYQEINLAPNLTVAENIFLGSEITRAGMVKRHQMA
DEAQQVINRLGAQFSATDKVSRLSIAEQQQVEIARALHRNSRILVMDEPTAALSNRETEQ
LFALIKRLRSEGMAIIYISHRMAEVYELSDRVSVLRDGQYVGSLTRDNLNASELVRMMVG
RPLSDLFNKDRTIARGAVRLAVNHLSDGDKVHPSSLEVRAGEIVGLAGLVGAGRSELAQL
IFGVHRLQQGDVWIDGQKVDIHSPREAIAHGIGFLTENRKEQGLFLEMAAQENIVMATLE
RDARYGMLNRGKSRKIASEAISSLNIRVPHALVRAGGLSGGNQQKLLISRWIAIGPRILI
LDEPTRGVDVGAKSEIYRMMQEMARQGIAILMISSELPEVVGMSDRVYVMHEGAIAGELA
GDTITQENIMTLATGAHSASPLEV
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgacagcaaagccgatactcgaaatgcgcgagatcacccgacgctttggtaatttttac
gccttgaaaggggtagatctcacggtgtatcccggtgaggtccatgccctgatgggcgaa
aatggcgcgggtaaaagcaccctgatgaagatcctggcgggggcctatgcggccagcagc
ggcgaggtgctaattgatggcaaaccctggcagctgaaaggccctaaagaggcgttagcc
gccggaatcacgctgatctatcaggaaatcaatctggcgcccaatcttaccgtggcggaa
aacatctttctgggcagtgaaattacccgtgcaggcatggtgaaacgtcatcagatggcg
gatgaggcgcagcaggtgatcaaccggttgggcgcgcagtttagcgccaccgacaaagtc
agcaggctgagtattgctgagcagcagcaggtggaaattgcgcgcgccttacaccgtaac
agccggattctggtgatggatgagccgactgccgcactctcgaaccgtgaaaccgaacaa
ctgtttgccctgatcaagcgcctgcgtagcgaaggcatggccattatttacatcagtcat
cgtatggcggaagtgtatgagctgtcagatcgcgtcagcgtgctgcgtgacgggcagtat
gtcggcagcctgacgcgcgacaatctgaatgccagcgagctggtgcgcatgatggtgggg
cggccgctcagcgacttgttcaataaagaccgcacgatagcgcgcggggccgtccggctg
gccgtcaatcatctgtccgacggcgacaaagtgcatcccagcagccttgaggttcgcgcg
ggcgaaatcgtcggcctggccggcctggtaggcgcgggacggagcgagttggcacagctg
atttttggcgtgcaccggcttcaacagggcgacgtctggatcgatggtcagaaggtagat
attcattcgccacgtgaggcgattgcgcacggaattggttttcttaccgagaaccgtaaa
gagcaggggctgtttctggagatggccgcgcaggaaaacatcgttatggccacgctggag
cgtgatgcccgctacggcatgcttaaccgcgggaaatcgcggaaaattgccagcgaagcg
atctcctcgctcaacattcgcgtgccccacgcgctggtgcgtgcgggcggcctgtcgggc
ggcaaccagcaaaagctgctgatttcccgctggatcgctatcggtccccgtattttgatt
ctggatgagccaacgcgaggcgttgacgtcggcgcgaaaagcgaaatttatcgcatgatg
caggaaatggcgcgtcagggcatagccattctcatgatctccagcgaattaccggaggtt
gttggcatgagcgatcgggtttatgtgatgcatgagggtgccatcgccggagagctggcg
ggcgatacgatcactcaggaaaacatcatgacgctggcaaccggtgcgcacagcgcatca
ccgcttgaagtatga

DBGET integrated database retrieval system