KEGG   Pantoea ananatis AJ13355: PAJ_1686
Entry
PAJ_1686          CDS       T01969                                 

Gene name
virA
Definition
(GenBank) wide host range VirA protein
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: HATPase_c Response_reg PAS_7 HAMP HisKA FleQ JAKMIP_CC3 HATPase_c_3
Other DBs
NCBI-ProteinID: BAK11766
UniProt: A0A0H3KXI0
Position
2041637..2044237
AA seq 866 aa
MQRSSPWQVGARGRLLLSHLLVVCVTLMVSVVAVTSFRHAGTIQAQAQAQTLADMNGSLA
LARDTANVAITAVRLSQVVGALEYQSESRRLQQNQQALQHSLSLLASTPLAAREPERVAR
LRARSLMLEQSVSMLLRQGHERHLQRNRVLSGLWQSQLLLERINDLTQRDGINAPDLTLR
QQTGRLLDIAIRTPSSTAVIEHLQQVMMQWRSVVAPGALGDNVQQLLETQRGLVPLAAEL
EESDLAIAYATYRIKALVAALNDDITAYVQQVAQQTERRNITTHHQLDSVSSFIMLSALL
ALAITLYTGYYIYRNLGSSLTAIAGAMTRLAQGEQNVSVPGLQRRDELGELARAFNVFAR
NTASLAQTSRLLEEKSTQLESTFLAMRDGFALFDNSGELVVWNAQYPALLGIAPRDLHRG
LHYQQLLEPLNVQLHDLAEPQEVRLADGRTLELRFSPVPRRGMVNTVLERTSRKVLEEAL
VHSQKMKAVGQLTGGIAHDFNNLLAVIIGSLALTEGQLAPGPVASRIERARQAADRAALL
TQRLLAFSRKQTLNPHAVSVVTLIENLQGLLQHSLLPGQHLIIDAQRPGWPAWIDASQLE
NAVMNLVVNARDAMGGQSGEIRLRIWNQRRSEQGEKRDRVTIEVIDHGCGMSDEVRAQVF
EPFFTTKTTGTGSGLGLSMVYGFVRQSGGQVELETAPGQGTTVRLLLPRAPDAAAARPPV
PAPSHPAAADDRLILVLDDEPAVRQTLCEHLHQLGYLTLECATGEEALALLHQTPDIDLL
ISDLMLPGEINGAEVIRQAQQKWPQLATLLISGQDLRHQPVTLPLCERLAKPWQAAQLVE
ALQRAWQRSARLNRARQAATTAPVSQ
NT seq 2601 nt   +upstreamnt  +downstreamnt
atgcaacgcagttcaccgtggcaggtcggggcgcgcggtcgcctgttgctgtctcattta
ttggtggtgtgcgtcacactaatggtgagcgtggtggcggtgaccagttttcgccatgcg
ggcaccattcaggcccaggctcaggcgcagacgctggctgatatgaacggcagccttgcc
ctggcgcgcgataccgccaatgtggccatcacggcagtgcggttgtcccaggtggtcggt
gcgcttgagtatcagagcgaatcacgacgtttacagcagaaccaacaggccctacagcac
tcactctctttactggcgagcacgccgcttgccgcgcgtgagcctgaacgcgtggcgcgc
ctgcgtgcgcgtagcctgatgcttgagcagtcggtgagtatgctgttgcgtcaaggccat
gaacgccatttacagcgcaacagggtgctaagcggcttgtggcagtcacaactgctgctt
gaacgcattaatgatctgacacagcgcgacggcatcaacgcacccgatttaacgctgcgc
cagcaaaccggcaggctactggatatcgcgattcgcacgccgtcatcgacggcggtcatc
gagcacctgcaacaggtgatgatgcaatggcgcagcgtggtcgcgccaggtgcactgggc
gacaatgtacagcagttgctggaaacacagcgcggcctggtcccgttggccgcagagctg
gaggagagtgacctggcgattgcctatgcgacttaccgtatcaaggcgctggtggcggcg
ctgaatgatgacattaccgcttacgtccagcaggtcgcgcagcaaacggaaaggcgtaac
atcaccacccatcatcaactcgactcggttagcagctttatcatgctgtctgccctgctg
gcgctggccatcaccctctataccgggtactacatttaccgcaatctgggctccagtctt
accgccattgccggtgcgatgacccggctggcacagggagagcagaacgtcagcgtgccg
ggattacaacgtcgggacgaactgggtgaactggcgcgcgcgtttaacgtttttgcgcga
aataccgcctctttggcccagacttctcgcctgctagaagaaaaaagcacccaactggag
tcaaccttcctggccatgcgtgacggttttgccctgtttgataacagcggagaactcgtg
gtatggaatgcgcagtatccggcgctgctgggcatcgctccccgcgatctgcatcgcggt
ttgcactatcagcaattgctggagccgcttaatgtgcagttgcacgatttagcggaaccc
caggaagtgaggctggcagacggccgcacgctggaactgcgtttcagcccggtaccacgg
cgcggaatggtcaatacggtgctggagcgcacttcgcgtaaggtgctggaagaggcgctg
gtgcacagtcagaaaatgaaagcggtgggccagttgaccggcggcatcgcccatgatttt
aataacctgctggccgttatcatcggcagcctggcgttaaccgaggggcaactggcaccc
ggccccgtcgccagccggattgaacgagcccgccaggcggcagacagagcggcgcttctg
acccaacggctgctggccttttcacgcaaacaaaccctgaatccccacgcggtttccgtg
gtgacattgatcgagaatctgcaggggctgcttcagcattcgctgctgcccggtcagcat
ctgatcatcgatgcccagcgccccggctggccggcctggatagatgccagccagttggag
aatgcggtgatgaatctggtggtcaatgccagggatgcaatgggtggccaaagcggcgaa
atccgcctgcgcatctggaatcagcggcgaagcgagcaaggggaaaaacgtgaccgggtg
accatcgaagtgatcgatcacggctgcggcatgtccgatgaggtgcgtgctcaggtgttc
gaacccttcttcaccactaagaccaccggaaccgggagcgggctgggactgtcgatggtg
tacggctttgtccgccagtcgggtggacaggtggagctggaaacggcccccggtcagggc
acaacggtgcggctgttgctgccgcgcgcgcccgatgccgcagccgcccggccccccgtc
cctgccccgtctcaccccgcggctgcagacgatcgtctgattctggtactggatgatgaa
ccggcggtgcggcaaaccctgtgcgagcacctgcatcaactcggctatctgacgctggag
tgcgcgaccggcgaagaggcgctggcgctgttgcaccagacacccgatatcgatctgtta
atcagcgatttgatgttgcccggtgagataaacggcgcagaggtcattcgtcaggcgcag
caaaagtggccacagctggcaaccttgctgatcagcggccaggacctgcgccaccagccc
gttacgctgccgctgtgtgagcggctggcgaaaccctggcaggcggcacagttggtggag
gcgctgcagcgcgcctggcagcggagtgcaaggcttaatcgtgcccgccaggctgccaca
acggcaccggtttcccaatga

DBGET integrated database retrieval system