KEGG   Pantoea ananatis AJ13355: PAJ_1687
Entry
PAJ_1687          CDS       T01969                                 

Gene name
phnE
Definition
(GenBank) phosphonates transport system permease protein PhnE
  KO
K02042  phosphonate transport system permease protein
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PAJ_1687 (phnE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_1687 (phnE)
Transporters [BR:paj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    PAJ_1687 (phnE)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: BAK11767
UniProt: A0A0H3L4K7
Position
complement(2044191..2045075)
AA seq 294 aa
MVTLAPDITAMKQQHHELFAAQHRYLRRLAMLALALVLYYVFFFMVYGIEWGRLLVGCQQ
LGRYFLRMFVWQDFANWPFGYYFSQVGITLAIVFAGTITATLLALPLSFLAARNVMHDKV
ARPIAFLMRRLFDMLRGIDMAIWGLIFVRAVGMGPLAGVLAIILQDVGLLGKLYSEGHEA
VERSPSRGLGALGANSLQKHRFGIFTQSFPQFLALSLYQIESNTRSAAVLGFVGAGGVGL
VYAENMRLWNWDVVMFLTLILVVVVMIMDAISSRLRKRYIIGKPVPLWQPGGHD
NT seq 885 nt   +upstreamnt  +downstreamnt
atggttactctcgcgccggatatcacggcgatgaagcagcagcatcatgaactcttcgct
gcgcagcaccgctatctgcgccgtctggccatgctggcgctggcgctggtgctttattac
gtctttttctttatggtctacggtatcgagtggggccgcctgctggttggctgccagcag
ctgggacgctattttttgcgtatgtttgtctggcaagactttgccaactggccctttggc
tactatttctctcaggtcgggattacgctggcgatcgtgtttgccggcacgataaccgcc
acgctgctggcgctgccgctgtcctttctggcggcgcgtaatgtgatgcacgataaagtt
gccagaccgattgctttcctgatgcgccgcctgttcgacatgctgcgcggcattgatatg
gcgatctggggcctgatctttgtgcgtgccgtcggcatggggccgttagccggggtgctg
gcgattatcctgcaggacgttggcctgttaggtaagctctattcggaaggacatgaagcg
gtggagcgttcgccgagtcgtgggctgggtgcactgggggcgaacagcctgcagaaacac
cgtttcggcatcttcacccagtcgtttccgcagtttctggcgctcagcctttaccaaatc
gagtcgaatactcgctcagcagcggtgctcggctttgttggcgcaggcggtgtcggcctg
gtttatgctgagaatatgcgtctgtggaactgggatgtggtgatgttcctgacgttgatt
ctggtggtcgtggtgatgatcatggatgccatctcaagccgcctgcgtaagcgttatatc
attgggaaaccggtgccgttgtggcagcctggcgggcacgattaa

DBGET integrated database retrieval system