KEGG   Pantoea ananatis AJ13355: PAJ_1688
Entry
PAJ_1688          CDS       T01969                                 

Gene name
ptxC
Definition
(GenBank) phosphite transport system permease protein PtxC
  KO
K02042  phosphonate transport system permease protein
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PAJ_1688 (ptxC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_1688 (ptxC)
Transporters [BR:paj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    PAJ_1688 (ptxC)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: BAK11768
UniProt: A0A0H3KXF8
Position
complement(2045078..2045827)
AA seq 249 aa
MAEFNLVTIWQSLPHFFDYIREIMPVLHLPLLFADGKTEGSLAYWGYRLNIQLPLIWETL
QLALASTLVAVVIAGILAFFAADNTQTPASLRMGIRAFVAFLRTMPELAWAVMFVMAFGI
GAIPGFLALALHTIGSLTKLFYEAIESASDKPVRGLAACGASKLQRMRFAFWPQVKPTFL
SYSFMRLEVNFRSSTILGLVGAGGIGQELMTNIKLDRFDQVSMTLLLILIVVSLLDTVSG
RLRRRVVEE
NT seq 750 nt   +upstreamnt  +downstreamnt
atggcagagttcaatctggtgaccatctggcagtcgttgccgcacttttttgattatatc
cgtgaaatcatgcccgttttgcatctgccgctcctgtttgccgatggcaaaacggaaggg
tcgctggcctactggggctatcgtctgaatattcagctaccgctgatctgggaaaccctg
cagctggcgctggcctccacgctggttgccgtggtgattgccggtatcctggcgtttttt
gcggccgataatacgcaaacgcccgccagcctgcgcatgggcattcgcgcctttgtcgca
tttttacgcaccatgcctgaactggcctgggcggtaatgtttgtgatggcgtttggcatc
ggggcgattcccggctttctggcgctggccctgcatactatcggtagcctgaccaaactg
ttttatgaagccatcgaatcggcgtcggataagccggtacgcgggctggcggcctgcgga
gccagcaagctgcaacggatgcgctttgcgttctggccccaggtcaagcccacctttttg
tcttacagctttatgcgcctggaggttaacttccgctcatcgaccattctggggctggtc
ggggcaggcgggatcggccaggagttaatgaccaacattaagctggatcgcttcgatcag
gtcagcatgacgctgctgttgattctgattgtggtgtcgttactggatacggtttctggc
cgcctgcgccgccgtgtcgtggaggaataa

DBGET integrated database retrieval system