KEGG   Pantoea ananatis AJ13355: PAJ_1689
Entry
PAJ_1689          CDS       T01969                                 

Gene name
phnD
Definition
(GenBank) phosphonates-binding periplasmic protein precursor PhnD
  KO
K02044  phosphonate transport system substrate-binding protein
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PAJ_1689 (phnD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_1689 (phnD)
Transporters [BR:paj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    PAJ_1689 (phnD)
SSDB
Motif
Pfam: Phosphonate-bd SBP_bac_3 NMT1 Rhamnogal_lyase
Other DBs
NCBI-ProteinID: BAK11769
UniProt: A0A0H3KX55
Position
complement(2046062..2046991)
AA seq 309 aa
MKMKAFALLTTALLTFGVNAADAPKELNLGILGGQNATQQIGDNQCVKTFFDKELNVDTK
IRNSSDYSGVIQGLLGGKVDLVLSMSPSSYASVYIQDPKAVDLVGIVVDDKDQSRGYHSV
VIVKADSPYKKLEDLKGKSFGMADPDSTSGFLVPNQAFKKMFGGNIDNKYNNFFSSVTFS
GGHEQDILGVLNNQFDGAVTWTSMVGDYNTGYTSGAFGRLIRMDHPDLMKQIRIIWQSPL
IPNGPILVSNKLPADFKAKVIAAIKKLDKDDHACFTKAVGGQQHIGKTSVADFQNIIDMK
RELMKGARG
NT seq 930 nt   +upstreamnt  +downstreamnt
atgaaaatgaaagctttcgcgttattgactacagcattgcttacctttggcgttaacgca
gcggacgcaccaaaagagctgaatctgggtattttaggcggtcagaacgcgactcagcag
attggtgataaccagtgtgtgaaaacgttctttgataaagaactgaacgtggataccaaa
atccgcaactcttcagactattccggcgtgattcaggggctgctgggcggtaaagtggat
ctggtattgagtatgtctccttcctcgtatgcgtccgtgtatattcaggatcccaaggcc
gtcgatttagtgggcattgttgtggatgacaaagatcagtctcgcggttatcactccgtg
gtgattgtgaaagccgacagcccttataagaagctggaagatctgaaaggcaaatctttt
ggtatggcggatcccgattccacatccggtttcctcgtgccaaaccaggcgtttaagaaa
atgtttggcggcaacatcgacaataaatacaacaacttcttttcaagcgtgaccttttca
ggtggtcatgagcaggacatcctgggcgtgctgaataatcagttcgacggcgcggtgacc
tggacctctatggtcggtgattacaacacgggctacacctctggtgcctttggccgcctg
atccgcatggaccatccggacctgatgaaacagattcggattatctggcagtcgccgtta
attcctaacggtcctatcctggtgagcaataaactgccagcggatttcaaagcgaaagtc
atcgccgcgatcaaaaaactggataaagacgatcacgcctgtttcaccaaagccgtaggg
ggccagcagcacattggcaagacctcggtagcggacttccagaacatcatcgatatgaaa
cgcgagctgatgaaaggcgcgcgcggctaa

DBGET integrated database retrieval system