KEGG   Pantoea ananatis AJ13355: PAJ_1690
Entry
PAJ_1690          CDS       T01969                                 

Gene name
phnC
Definition
(GenBank) phosphonates import ATP-binding protein PhnC
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PAJ_1690 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_1690 (phnC)
Enzymes [BR:paj01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     PAJ_1690 (phnC)
Transporters [BR:paj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    PAJ_1690 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase SMC_N AAA_29 AAA_16 KdpD MMR_HSR1 AAA_22 AAA_15 AAA_30 ATP-synt_ab Zeta_toxin AAA_23 DnaB_C NACHT Cellulase AAA_25 AAA_28
Other DBs
NCBI-ProteinID: BAK11770
UniProt: A0A0H3L1M7
Position
complement(2047017..2047847)
AA seq 276 aa
MAQALLKTVVDNVSSLTQSGGQKVLSVQGLSKAYGNNKVLDNVSFDLHAGELVAVIGRSG
AGKSTLLHMLNGTISASQGAIVSLHHGEADRDVVNLSSRQMREWRTQCGMIFQDFCLVPR
LDVLTNVLLGRLSQTSTLKSFFKVFSDTDRARAIQLLEWMNMLPQALQRAENLSGGQMQR
VAICRALMQNPKILLADEPVASLDPKNTTRIMDVLRQVSDQGISVMVNLHSIELVKSYCT
RVIGIQRGVVLFDGHPSALTDSLLHQLYGDEFNQIH
NT seq 831 nt   +upstreamnt  +downstreamnt
atggcacaggcactgcttaaaacggtggtcgataacgtctcgtcattgacccagtcaggc
gggcaaaaagtgttatctgttcagggactgagcaaagcttacggtaacaacaaagtcctc
gataatgtcagtttcgatttgcatgcgggtgaactggtagcggtaatcggtcgctctggc
gcaggcaaatcgacgctgctgcacatgctgaatggcacaatttccgcctcacagggcgcc
atcgtcagcctgcaccacggcgaagccgatcgcgatgtggtgaatctcagcagccgccag
atgcgtgaatggcgcacccagtgcggcatgatctttcaggatttctgcctggtgcctcgc
cttgatgtgctgaccaacgtgctgttggggcgtctcagccagacctctacgctgaaatcg
tttttcaaagtgttctctgacaccgaccgcgcccgcgccattcaactgcttgagtggatg
aacatgctgccgcaggcgttacagcgcgccgaaaacctctccggcggtcaaatgcagcgc
gtagcgatttgtcgggcgctgatgcagaaccccaaaattctgttagcggatgaacccgtt
gcctcgctcgatcctaaaaataccacccgtattatggatgtattgcgtcaggtcagcgat
cagggcatcagcgtgatggtgaatctgcactcgattgaattagtaaaaagttactgcacg
cgcgtgataggtattcagcgcggtgtggtgctgttcgacggtcatccttccgcacttacc
gacagcttgctgcatcagctgtacggcgacgaatttaaccagatccactaa

DBGET integrated database retrieval system