KEGG   Pantoea ananatis AJ13355: PAJ_1692
Entry
PAJ_1692          CDS       T01969                                 

Gene name
phnN
Definition
(GenBank) ATP-binding protein PhnN
  KO
K05774  ribose 1,5-bisphosphokinase [EC:2.7.4.23]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00030  Pentose phosphate pathway
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PAJ_1692 (phnN)
Enzymes [BR:paj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.23  ribose 1,5-bisphosphate phosphokinase
     PAJ_1692 (phnN)
SSDB
Motif
Pfam: AAA_18 Guanylate_kin AAA_33 AAA_16 AAA_29
Other DBs
NCBI-ProteinID: BAK11772
UniProt: A0A0H3L4L2
Position
complement(2048788..2049324)
AA seq 178 aa
MARLIWLIGPSGSGKDSLLDLLREAPPDGLLIAHRYITRPHDVGGENHVALTEAEFIRRK
ALGLFAVSWQAHGFHYGIGSEIDGWLACGQNVLVNGSRQHLEQVRARYGARLLPLCIEVS
PLVLAARLRQRGRESEEEIVQRLARAAQHQPEGCLRLNNDGALVDTVQQLRQLLAEFP
NT seq 537 nt   +upstreamnt  +downstreamnt
atggcccggcttatctggctcatcggcccgtccggctcaggaaaggacagcctgctggac
ctgctgcgcgaggcgccgcctgacggcctgctgattgcgcaccgctatatcacccgccct
cacgatgtggggggcgaaaaccacgtggccctgacggaagcggagtttatccggcgcaag
gcgctggggttatttgcggtcagctggcaggcccacggttttcattacggtatcgggagt
gaaatcgatggctggctggcgtgcgggcagaacgtgctggtaaacggctcccgtcagcat
ctggaacaggttcgtgcgcgttacggcgcacggctgttgccgctgtgcattgaggtttcg
ccattggtgctggccgcgcgtttacgacagcggggacgtgagagtgaagaggagatcgtt
caacgactggcgcgcgcggcgcaacatcagccagagggctgcctgcggctgaacaatgat
ggtgcgctggtggatacggtacaacagttacgacagctgctggcggaattcccatga

DBGET integrated database retrieval system