KEGG   Pantoea ananatis AJ13355: PAJ_1693
Entry
PAJ_1693          CDS       T01969                                 

Gene name
phnM
Definition
(GenBank) protein PhnM
  KO
K06162  alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase [EC:3.6.1.63]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00440  Phosphonate and phosphinate metabolism
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    PAJ_1693 (phnM)
Enzymes [BR:paj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.63  alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase
     PAJ_1693 (phnM)
SSDB
Motif
Pfam: Amidohydro_3 Amidohydro_1
Other DBs
NCBI-ProteinID: BAK11773
UniProt: A0A0H3KXG0
Position
complement(2049324..2050460)
AA seq 378 aa
MIINNVKLVLENEVVEGSLEFREDRITNFSETASQLAGALDGEGAFLLPGLVELHTDNLD
KFFTPRPKVDWPAHSAMSSHDALMVASGITTVLDAIGVGDVRDGGHRLENLSKMIGAIRD
SNRKGLNRAEHLLHLRCELPHHTTLPLFEALISSPELSLVSLMDHSPGQRQYASLEKYRE
YYQGKYQLNDEQMDEFERDQLALAREWSQPNRLAIAALCREHGIAIASHDDATEAHVEES
HGVGSAIAEFPTTLEAAKASRYCNMQVLMGAPNIVRGGSHSGNVAAWELASHGMLDILSS
DYYPGSLLDAAFRLAADERNTLSLSQSVALVTCNPARALGLEDRGVITEGCRADLVLAHT
QHGHPHIRHVWSKGRQVY
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgatcatcaataatgtaaagctggtgctggaaaacgaagtggtagagggatcgctggag
tttcgtgaagaccgcattaccaactttagcgaaaccgccagccagctcgccggcgcgctg
gacggagagggcgcgtttctgttgcccggcctggtcgagctgcacacggacaacctggat
aagttcttcaccccgcggcctaaggttgactggccggcccattccgccatgagcagccac
gatgcgctgatggtggccagcggcatcaccaccgtgctggatgccatcggcgtaggtgat
gtacgcgatggggggcaccggctggaaaatctcagcaaaatgattggcgcgattcgtgac
agtaaccgcaaggggctcaaccgcgccgagcatttattacatctgcgctgcgaactgccg
catcacaccacgctgccgctgtttgaggcgctcatctcctcaccagagctgtcgctggtc
tcgctgatggaccattcaccggggcagcgccagtacgcatcgctggaaaagtatcgcgag
tactatcagggaaaatatcagctcaatgacgagcagatggacgagtttgagcgcgatcag
ctggcgctggccagagagtggtcacagcccaaccgcctggcgattgccgcgctgtgccgg
gaacatggtattgcgattgccagccacgatgatgcgaccgaagcgcacgtggaagagtcg
cacggcgtgggcagcgcgatagctgaattccccaccacgctggaggcggcgaaggcgtca
cgttattgcaatatgcaggtgttaatgggcgcaccgaatattgttcgcggtggctcgcac
tccggtaacgtagccgcctgggagctggcatcacacggaatgctggatattctgtcatcg
gactattatcccggcagcctgttggatgcggccttccgcttagcggcggatgagcggaac
acgctgtcactgtcccagtctgttgcgctggtcacctgtaatccggcgcgcgcgttgggg
ctggaggatcgtggcgtgattacggaaggctgccgcgccgacctggtactggcgcatacc
caacatggtcatccccacatccgccatgtctggagcaaaggccggcaggtgtactga

DBGET integrated database retrieval system